KEGG   Drosophila mojavensis: Dmoj_GI21244Help
Entry
Dmoj_GI21244      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
dmo  Drosophila mojavensis
Pathway
dmo04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Dmoj_GI21244
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dmo01002]
    Dmoj_GI21244
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dmo04147]
    Dmoj_GI21244
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     Dmoj_GI21244
Peptidases [BR:dmo01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Dmoj_GI21244
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmoj_GI21244
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 6580969
NCBI-ProteinID: XP_002006762
FlyBase: FBgn0143974
UniProt: B4KTX1
LinkDB All DBs
Position
Unknown
AA seq 256 aa AA seqDB search
MFKFVILLSVVACAFGAAIPEGLLPQLDGRIVGGSPTSISSFPWQISLQRNGGHSCGGSI
YNSRIIVTAAHCLQGVSASSLKVRAGSSYWNSGGSLIQVAAFRNHEGYNPNTMVNDIAVI
RLSSSLSFSSNIKAIGLASSNPANGAAASVSGWGTQSSGSNSIPTQLQYVNVNIVSQSRC
ASSAYSYGSQIKNTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGVGCAYNNYPGVYA
DVAVLRSWVVNAANSI
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagttcgtcattttgttgtcggtcgtcgcctgcgcctttggtgctgctatccct
gagggtctcctgccccagttggatggacgcatcgttggcggctctcccacctccatcagc
agtttcccttggcagatctccctgcagcgtaatggcggccactcctgcggtggttccatt
tacaactccaggattatcgtgaccgctgctcactgtctgcagggcgtgtccgcctccagc
ttgaaggtgcgcgccggttccagctactggaactctggtggctccctcatccaggtcgct
gccttcaggaaccacgagggctacaaccccaacaccatggtcaacgacatcgctgtcatc
cgcctgagctcttccctgtccttcagctccaacatcaaggctatcggtctggctagttct
aatcctgccaacggcgctgctgcttccgtctctggctggggcacccagtcatctggatcc
aactccatccccacccagctgcagtacgtcaatgtgaacattgtcagccagtcccgttgc
gcctccagtgcctacagctatggtagccagatcaagaacaccatgatctgcgccgctgcc
tccggcaaggatgcctgccagggtgactctggcggcccattggtttctggtggtgtcctc
gtcggtgttgtctcctggggtgttggctgtgcctacaacaactatccaggtgtctacgcc
gatgtcgctgtcctccgctcctgggtggtcaacgctgccaactcgatctaa

DBGET integrated database retrieval system