KEGG   Drosophila mojavensis: Dmoj_GI22936Help
Entry
Dmoj_GI22936      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00040  Pentose and glucuronate interconversions
dmo00051  Fructose and mannose metabolism
dmo01100  Metabolic pathways
Module
dmo_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dmoj_GI22936
   00051 Fructose and mannose metabolism
    Dmoj_GI22936
Enzymes [BR:dmo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     Dmoj_GI22936
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Pyr_redox_2 Glyco_tran_WecB Sacchrp_dh_NADP Methyltransf_16
Motif
Other DBs
NCBI-GeneID: 6573617
NCBI-ProteinID: XP_001999683
FlyBase: FBgn0145663
UniProt: B4K5T2
LinkDB All DBs
Position
Unknown
AA seq 360 aa AA seqDB search
MAKDNLTAVLHGIEDMRLEQRPIPNISPEEVLIAMDSVGICGSDVHYLTKGRIGHFVVTK
PMVIGHESAGVVAKVGSKVKNLTVGDRVAIEPGVPCYKCDHCKQGSYNLCPDMVFCATPP
YDGNLTRYYKHAADFCFKLPDHVTMEEGALLEPLSVGVHACKRAGVSLGSRVLILGAGPI
GLVTLLVAQSMGATEILITDLVQHRLDIAKELGATHTLLLTSDETAEQVADRVRKAMGED
PDISIDCCGAESTTRLAIFATRAGGVVVIVGMGPPEMKLPLFNALAREVDIRGVFRYCND
YAAALALVASGKVKVKRLVTHHFDIQETQKAFQTARTGTGGAIKVMIHVQPRNTNNPVKF
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggataacctaacggctgttttacatggcattgaggacatgcgcttggaacag
cgtcctataccgaatatttccccagaagaggttttaatcgcaatggatagcgtcggaatt
tgtggatcagatgttcattatttgactaaaggtcgtatcggccactttgtggtgaccaag
cccatggtaatcggccacgaaagcgcaggtgtggttgccaaagtgggcagcaaagttaag
aatctgactgtaggagaccgagttgccattgagccgggagttccttgctacaaatgcgat
cattgcaagcaaggcagctacaatctgtgtcccgatatggtattctgtgccacgccccct
tacgatggtaacctgacccgatactataagcacgcagcggacttttgctttaagttgcct
gatcatgtcaccatggaggagggtgcgttactagaacctctatccgtgggagtgcatgcc
tgcaaacgtgcaggcgtcagcttgggatcgagggtgctgattctaggtgcaggtcctatt
ggattggttacactgctggttgctcaatccatgggtgcaacggaaattttaataaccgac
ctggtgcaacaccgtctggacattgctaaagagctaggcgccactcacactctgctgctg
acgagtgatgagacagctgagcaggtcgcggatcgtgtgcgtaaagcaatgggtgaggac
cccgacatatcgattgactgctgtggagcggagagcactacacgtttggcgatctttgct
acacgagcaggaggtgttgttgttattgttggcatgggaccgcctgaaatgaagctgccc
ctattcaatgccctggctcgagaggtagacattcgcggtgtcttccgttactgcaatgac
tatgccgctgctttggccctggtggcttctggaaaagtgaaagtaaagcgacttgtcacc
caccactttgatattcaagagacacaaaaggcattccaaacagctcgtactggcacgggc
ggtgccattaaagttatgatacatgttcaacctaggaataccaacaatcctgtaaaattt
tag

DBGET integrated database retrieval system