KEGG   Drosophila mojavensis: Dmoj_GI23014Help
Entry
Dmoj_GI23014      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dmoj_GI23014
Enzymes [BR:dmo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dmoj_GI23014
Chromosome and associated proteins [BR:dmo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Dmoj_GI23014
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1 Methyltransf_4
Motif
Other DBs
NCBI-GeneID: 6573472
NCBI-ProteinID: XP_001999553
FlyBase: FBgn0145741
UniProt: B4K4N8
LinkDB All DBs
Position
Unknown
AA seq 2163 aa AA seqDB search
MATPQVKDLVLRSPAGSSDTITFAWPLQVGHGQDKHDNGIDIIDTIKFVCDELPSISSAF
EEINLNHIDTACYKTMTNLVDRFNKAVDSIVALEKGTSLPAERLNKFAHPSLLRHILQLV
YNAAVLDPDKLNQYEPFSPEVYGETSYELVQQMLKHVTVSKEDTFIDLGSGVGQVVLQMA
GSFPLKTCIGIEKADTPARYAERMDQIFRQYMGWFGKRYCEYKLIKGDFLVDEHREKITS
STLVFVNNFAFGPTVDHQLKERFADLRDGARVVSSKSFCPLNFRITDRNLSDIGTIMHVS
EIPPLKGSVSWTCKPVSYYLHVIDRTILERYFQRLKTKGGDHEHVGTVRTTRDRAKREAN
TGHNNNHNNNNQHNNNSQQREQREQQREREREIFNGPAQQRHQSQSPANVSGSNGNGNGN
GSGQHASKTRQQLTHQQQMQQRNLNMDSSTESDADGEVNNGNCGNTTTATNTTSASNGPM
TRKVWSDWCSSKGKSSQSDDEENNNSNSNNSNSNSNSHQGRAPRAVTTLKKRKKLTRKAA
IASKSAAAAQREAEEAAAVAAVAASATSASASKDSSSKEDQPRAASAGPGRKGRMKKGQR
GRKCLKIAGLDVLHKQTVLSTSLDAMTKKLPAAPGTVDQQLTSLLTGDMSHRELDIPAAP
QDTPYALQILLDVFRSQYMAIIEQMRSSTYVPQVQKQIAQEQERMSRLKNRASQLDKQIK
VLIDDSVTLLKVRMNELGINVNSPNDLIAQAKEIVGRHKDLQHAVSKMRNEVTVYESEQK
LLLSKHLKHLPEYQKLCTVTTNGGNSKIKLEVPQELSETAAQELVLKEIANTLSQRKKLV
AQVSTIEQETSSLQKSAEERSTAAALLAQGTNISLASGAPTVPTNAATPAAQTNCTKVAS
GKASRRSREHRARSQEWPEVPEVGKIQESNPEVLAQKILETCRQVEAGKFQPPPAAVSAS
SASSTANPISYVNGKPKAEPKTSPALYKDSTLMPAPKQQSQAPQQTQQQAVLLPKCELPG
LGRKQESPKVANFEDRLKSIITSALNEDQEQRSKAMPIIEAPPAPLQSPASKRSKQMGQA
SSANNLHNIITVSTQGLMHLNANTTISPITPPLPGPRAAAAASTAPPPPANLPYGSAYMS
SKPQQQHHQQQHHQQQQHQHQQQHQQLQQLSSKYGQTVLLKESKYSPARPGASAPPPPPP
PPPSSSAASSAHMATLYASHGVSTAAPPTSADLGFHRRRASVSANSYEHFMAQQQQQQQH
ALMLAHVAQQRLQQQQQQQQQQQQQQQQQHLQQLAEQQQQQQQQQLQQQHQQSQQHNQEL
LPRASSANSDYAGYRVERLTVRPPSRPSSNSSQPDYTQVSPAKMALRRHLSQEKLSQPPQ
ALPTPPPMALAPPVTSGKTIGDLVTGEIERTLEISHQSIINAAVNMSTGNGSNSSAAHFM
ERAFLAERTNERLLINLNAQRPERVHVRPLNEDAPEPQPANYSQAASSSSSNLATLAHVA
YAHKPQPGARSASTGRTGRDYQSVALPRAEMMGCIEAYFHEEQQQHQQQQHQQQQHQQQQ
HQQQQQHQKSKGTVGGASTLRAPRLNGANPPLEGLAASLQDHVRARKYKEENEERQRRAA
AATSSALELAPHFAHQAPPAHSYHHHPAAGAINGTPHKVELGVKRSSPLASHQQPSRPAK
LAHFEQQPPAHAHQHLYVNSNGGSALPPPAHDATTPSPTPSSSSSSCGRRSKLLVEPPLL
MSPEINSLMGDERPLQLSTNHQQLHHHQQKPHQHAQQQLRALHQTSHSITPTIVGGQRSN
AGDDDDVIAADEESHWQHRVSSGFDRLVAFASTELDKTRRSIDGDTVPASISCNTSPDSG
ITHSSSNSDAVRTFLSTSSSSSQLELPINNSSSGSSSSTNSSLYASQVHNLSHHPYQHGH
QPLQQPMQQQLQQQQQPQQQQPQQQHQQQQHLADHLSDSSMKSTASSSLHASSSLKTISP
VDPSAIESPPLSDVGLPRTPSPSAASVATPPPVHAPSLVNDLRIPLKYQRKFKGGSEKHY
KKKFCERNWEYDCDELLAYSNSSAPPTAADAAGNGPPTALDASGMVAATPPAVLSKSGKS
PKEKSSPHHGANANANVNVNANASYHHHHKSSKFRPKGKDWDWSLDSRSNTGEPTANATT
SSN
NT seq 6492 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacctcaagtcaaagacttggtgttgcgctcgccagctggctcctccgatacc
atcacatttgcctggccactgcaggtgggacatggacaggataagcatgacaatggcatc
gacattatcgatacaattaaattcgtatgcgatgagctgccatccatttcatccgcattc
gaggagatcaacctcaatcacattgacactgcctgctataagactatgacaaatcttgtc
gatcgcttcaacaaagctgtcgacagtattgttgcattggaaaaaggaacttcactgccc
gccgagcgtttgaataaattcgctcaccctagccttttaagacacatactgcaattagtt
tacaatgctgccgtgctcgatccggacaagcttaatcagtacgagcccttttcgccggag
gtctatggcgagacatcgtacgagctggtacagcaaatgctcaagcatgtcaccgttagc
aaggaggacacgttcattgatctcggttccggtgtgggacaggtggtactacaaatggcc
ggatcgtttccgcttaaaacatgcattggtatcgagaaggcggatacgcccgctcgctat
gccgaacgcatggatcagatattccgccagtatatgggatggtttggcaaacgctactgc
gagtacaaactgatcaagggcgattttctggtcgatgagcatcgcgagaaaatcacctcc
tctacattggtgtttgtcaataactttgccttcggtccgaccgtggatcatcagctaaag
gagcgatttgccgatttgcgagatggcgctcgagttgtttcatccaaatcgttctgccca
ctcaactttcggatcacagatcgaaacctttctgatattggcaccattatgcatgtgagc
gaaataccgccgctgaagggctccgtctcgtggacctgcaagccggtttcatattattta
catgtgatcgatcgcaccattttggagcggtattttcagcgcctgaaaaccaagggcggt
gatcacgagcatgtgggtaccgttcgcaccacacgagatcgcgccaaacgtgaggctaac
actggccacaacaataatcacaataacaacaaccagcacaataacaatagccagcagcgg
gagcaacgggaacagcagcgcgagcgagagagggagatctttaacggtccagctcagcag
cggcatcagtcgcagtcgccggcgaatgttagcggctccaacggtaacggcaacggcaac
ggcagtggacagcacgcctccaagacgcgccaacagctgacgcatcagcaacagatgcag
caacgcaatctgaatatggatagcagcacggaaagcgatgcggatggggaggtgaacaat
ggaaattgcggaaacaccaccacagcgaccaacaccacgtccgcttcgaatgggccaatg
acgcgcaaagtgtggtcggattggtgcagctctaagggcaagagttcccagtcagatgac
gaggagaacaacaatagcaacagcaacaacagcaacagcaatagcaatagccaccaggga
cgtgcaccacgcgccgtcaccacgctgaagaagcgcaagaagctaacacgcaaggcggcc
attgccagcaaatcggcagcggctgcgcagcgggaagctgaggaggcggccgcagtcgct
gctgttgctgcatccgccacgtccgcttcggccagcaaggactccagcagcaaggaggat
cagccgcgcgcagccagtgccggtcccgggcgcaagggccgcatgaagaagggacaacgc
ggtcgcaagtgcttgaagatcgccggcctggatgtgctgcacaagcagacggtgctgagc
acctcgttggatgcgatgacaaagaagctgcccgccgcaccgggcacagttgaccagcag
ctgacgtcgctgctcactggcgacatgtcgcatcgtgaactggacattcctgcggcgcca
caggatacgccatacgcgctgcagatactgctcgatgtgttccgctctcagtatatggcg
atcattgagcagatgcgctcgagcacatatgtgccgcaggtgcagaagcaaattgcccag
gaacaggagcggatgtcgcgcttgaagaatcgagccagccagctggacaagcagatcaag
gtgctgatcgatgacagcgtgacgctgctcaaggtgcgcatgaatgagctgggcataaac
gtgaactcgcccaacgatctgatagcgcaggccaaggagattgtcggacggcacaaggat
ctgcagcatgcggtcagcaagatgcgcaacgaggtcaccgtctatgagagcgaacagaaa
ttgctgctgagcaagcatctgaagcatctgcccgaatatcagaaactgtgcaccgttacc
accaatggcggcaacagcaagatcaagctcgaagtgccccaggagctgtccgaaacggcg
gcccaggaactggtgctgaaggaaatcgccaacacgctgagccagcgcaaaaagctcgtt
gcacaggtctccaccatcgaacaggagactagctcgctgcaaaagtcagccgaagagcgc
agcacggcggcggcattgctggcccagggcaccaatatcagcctggccagtggcgccccc
accgtgccaacaaatgctgcaacgccggcggcgcaaacgaattgcaccaaggtggcaagc
gggaaggcgtcacgtcgcagccgcgagcatcgggcacgctcgcaggagtggcccgaggtg
ccggaggtgggtaagatacaggagagcaatcccgaggtgttggcccaaaagatactcgag
acctgtcgccaggtggaggcgggcaaattccagccgccgccagctgcagtcagcgccagc
agtgccagcagcaccgccaaccccattagctatgtgaatggcaagcccaaagcggagccg
aagacctcgcctgctctgtacaaggacagcaccctgatgccggcgcccaagcagcagtcc
caggcgccacagcagacgcagcagcaagccgtgctgttgcccaagtgcgagctgcctgga
ctggggcgcaagcaggagtcgccgaaggtggccaatttcgaggacaggctgaagagcatc
atcacatcagcgctcaacgaggatcaggagcagcgcagcaaagcgatgcccatcattgag
gcgccgccagcgccgctgcagtcgcccgcgtcgaagcgcagcaagcaaatgggccaagct
tccagcgccaacaatttgcacaatattatcacagtctcgacgcaaggtctgatgcacctg
aatgcgaacacgacgatatcgccgataactccacctttgccgggaccgcgggcagcagct
gctgcgtccacggcgccgccgccgcctgccaatttgccctatggcagcgcctacatgagc
agcaagccgcagcagcaacatcaccagcagcaacatcaccagcagcaacagcaccagcac
cagcagcagcatcagcaattgcagcagctgtcgagcaaatatgggcaaacggttttgctc
aaggagtccaagtactcgccggcaagaccaggtgcatcagcaccgccgccgccaccacca
ccgccgccgtcatcgtcagcggcatcgtcggcgcatatggcaacgctctacgctagccac
ggcgtctcgaccgcagcgccgcccacgtccgccgatctgggctttcatcgacgacgtgcc
tcggttagcgccaacagctacgagcactttatggcgcagcagcagcagcaacagcaacat
gcgcttatgctggcgcatgtggcacagcagcgactgcagcagcagcaacagcagcagcaa
cagcagcagcaacaacaacagcagcaacacttgcagcagctggcagagcagcagcaacaa
caacagcaacaacagctgcagcagcaacaccaacagtcgcagcagcacaaccaggagcta
ttgccacgggcgagttccgcaaactcggactatgctggctatcgtgtggaacggctaacc
gttcgacccccgagccgacctagctccaacagctcgcaaccggactacacgcaggtgtcg
ccagcgaagatggctctgcgtcggcatctctcgcaggaaaaactcagccagccgccgcag
gcgttgcccacaccaccgcccatggcactggcgcctccagtgacatcggggaagaccatc
ggggatctggtcactggcgaaattgagcgaacactggagatctcacatcagagcatcatc
aatgcggcggtcaacatgagcactggcaacggcagcaacagcagcgctgctcacttcatg
gagcgcgctttccttgccgagcgcaccaacgaacggctgctcatcaatctgaatgcccaa
cggccggagcgtgtgcacgttcgacccctcaacgaagatgcgccagagccgcagccggcc
aactacagccaggcggcatccagtagcagcagcaacctggccaccctggcgcacgttgcc
tacgcccacaagcctcagccgggagcaaggagcgcctcgacaggacgcacgggacgcgat
tatcagtcggtagcattgccgcgagccgaaatgatgggctgtattgaggcttactttcac
gaggagcagcagcagcatcaacagcagcagcatcaacagcagcagcatcaacagcagcaa
catcagcagcagcaacagcatcagaagtccaaaggaacagtcggcggtgccagcacgttg
cgcgcaccacgcctaaacggtgctaacccacctttagaaggactggccgcctcgctgcag
gatcatgtgcgagcacgcaaatacaaggaggagaacgaggagcgacaacggcgagctgct
gcagcaacttcatccgcattggaattggcgccgcatttcgcgcatcaggcgccgcccgct
catagctatcatcatcatccagctgccggcgctatcaatggcaccccacacaaagtggag
ctgggcgtaaagagaagctcgcccttggcctcacatcagcagccctcgcgacctgccaaa
ttggcgcatttcgaacagcagccgcctgcccatgcccatcaacatctgtatgtgaatagc
aacggtgggtcagcgctgccgccgcctgcgcatgatgccaccacgccgtctccgacgccg
tcgtcttcatcgtcgtcgtgtggcagacgcagcaagctgcttgtggagccgccgctgctg
atgagtcccgagattaattcactcatgggcgatgagcggccgctgcagctatcgacgaac
catcagcagctgcaccaccaccagcagaagccacatcagcatgcccagcagcagttgcgt
gccttgcatcagaccagtcacagcatcacgcccaccattgtgggcggccagcgctccaat
gccggtgatgacgacgatgtcattgcggccgacgaggaatcccattggcagcatcgcgtc
agctccggctttgaccggctggtggcctttgccagcaccgagctggacaagacgcgccgt
tccattgacggcgacacggtgcccgcttcgatcagttgcaacacctcgcccgactcgggc
atcacgcacagcagcagcaattcggacgcagtgcgcacctttttgtccacctcgtcgagc
tcatcacagctagagttgcccatcaacaacagcagcagcggcagcagcagcagcaccaac
agcagcctctacgctagccaggtgcacaatctgagccatcatccgtatcagcatggtcac
cagccgctgcagcagccaatgcaacagcagttgcagcaacaacagcagccgcagcaacag
cagccacagcaacaacatcaacagcagcaacacttggcagaccacttgagcgacagcagc
atgaagtcgactgcatcctcatccttgcacgcaagcagctcattgaagaccatttcgccg
gtagatccgagcgcaatcgagtcgccgccactctccgacgttggtctgccacgtacaccc
agtcccagtgcggcaagcgtggccacgcccccacctgtgcatgcaccgtcgctggtcaac
gatctgcgcataccgcttaaataccagcgcaagttcaagggaggatccgagaagcactac
aagaaaaagttctgcgagcggaactgggagtatgactgcgacgagctgctggcttactcc
aactccagtgcgccgcccacggccgccgatgcggcaggcaatggaccgccgactgcactg
gacgcatccggcatggtggcagcaacgccgccagctgtgctgagcaaatcgggcaaatcg
ccaaaagagaaatcatcgccccatcatggcgccaatgcaaatgccaatgttaatgttaat
gcaaatgccagctatcatcaccatcacaagtcctcaaagtttcggcctaagggcaaggac
tgggactggtcgctcgacagtcgcagcaacacgggcgagccgacggcgaatgccaccacg
tcgagtaattaa

DBGET integrated database retrieval system