KEGG   Drosophila mojavensis: Dmoj_GI23021
Entry
Dmoj_GI23021      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K17065  dynamin 1-like protein [EC:3.6.5.5]
Organism
dmo  Drosophila mojavensis
Pathway
dmo04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dmoj_GI23021
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dmo04131]
    Dmoj_GI23021
   03029 Mitochondrial biogenesis [BR:dmo03029]
    Dmoj_GI23021
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dmo04147]
    Dmoj_GI23021
   04990  Domain-containing proteins not elsewhere classified
    Dmoj_GI23021
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     Dmoj_GI23021
Membrane trafficking [BR:dmo04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Dynamin
    Dmoj_GI23021
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    Dmoj_GI23021
   RhoA-dependent endocytosis
    Dmoj_GI23021
Mitochondrial biogenesis [BR:dmo03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    Dmoj_GI23021
   Retention of mitochondria
    Dmoj_GI23021
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmoj_GI23021
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED Spt20 TFIIA MMR_HSR1 AAA_16 DDHD DUF5427 Ndc1_Nup DUF2722 EPL1 SpoIIP PAT1 TERB2 Med3 Neur_chan_memb eIF-3_zeta
Other DBs
NCBI-GeneID: 6577378
NCBI-ProteinID: XP_002003345
FlyBase: FBgn0145748
UniProt: B4KL37
LinkDB
Position
Unknown
AA seq 746 aa
MEALIPVINKLQDVFNTVGSDSIQLPQIVVLGSQSSGKSSVIESVVGRSFLPRGTGIVTR
RPLVLQLIYCPLEDREHRSAENGTVNAEEWGRFLHTKKCFTDFNEIRHEIENETERVAGN
NKGICPEPINLKIFSTRVVNLTLVDLPGITKVPVGDQPEDIEAQIKDLVVKYIENPNSII
LAVTAANTDMATSEALKLAKDVDPDGRRTLAVVTKLDLMDAGTDAIDILCGRVIPVKLGI
IGVMNRSQQDIIDKKDIDEQMKDEAAFLQRKYPTLATRNGTPYLAKTLNRLLMHHIRDCL
PDLKTRVNIMSTQFQSLLNSYGEDVSDKSQTLLHIITKFSSAYCSTIEGTARNIETTELC
GGARLCYIFHEIFGRTLDSIHPLAGLTKMDILTAIRNATGPRPALFVPEVSFELLVKRQI
RRLEEPSLRCVELIHEEMQRIVQHCGNEVQQEMLRFPKLHEKIVDVVTQLLRCRLPATNV
MVENIVAIELAYINTKHPDFHKEAALVPSLLKTDSDPFVQSRRTNTPRNTMSPQVSSHNS
MSQSQQPSQQLLQTQQQQQQQQQQQQQQQQQQQQQQQQQNDAHEQQNHNGDNSAGSWLSN
ILPPAPNRPDSIENSASNTPVHNNITPLKPVNLLPDVPQMANPRRLTDKEQRDCDVIERL
IKSYFYIVRKSIQDSVPKAIMHFLVNYVKDNLQSELVTHLYKSDKAETLLNESDHIAVRR
KEAADMLKALTRANHIISEIRETHMW
NT seq 2241 nt   +upstreamnt  +downstreamnt
atggaagcgcttattccagttatcaacaaattgcaagatgtcttcaacaccgtcggctct
gactcaatacaattgccgcaaattgttgtactcggcagtcagagttcaggcaaaagttct
gtcatcgagagcgtagtgggacgctcgtttctgccacgaggcacaggcattgtgacgcgt
cgtccgctggtgctgcaactgatttactgtccactcgaagatcgcgagcatcgctcagca
gagaatggcactgtcaatgcagaagaatggggacgctttctgcacacaaagaaatgcttc
acggacttcaatgaaatccgccacgagatcgagaacgaaacggagcgagtggcgggcaac
aacaagggcatctgtccggagcccattaatctaaagatattctcgacacgcgtcgtcaac
ctgaccctggtcgatttgccaggcattaccaaagtgcccgtcggggatcaacccgaggat
attgaagcccagattaaggatttggttgtcaaatatattgagaatcccaattcgatcatt
ttggccgtgacggcggccaatactgacatggcgaccagcgaggcgctcaagctggccaag
gatgtggatcctgatggcaggcgcacactggccgtggtcactaaactggatctcatggat
gccggcaccgatgccattgatattctctgcggacgtgtcataccagtcaaacttggcatc
attggtgtgatgaatcgatcgcaacaggacatcatcgataaaaaggacattgatgagcaa
atgaaggacgaggcggctttcctgcagcgcaagtatcccacattggccacacgcaacggc
acaccctacctggccaagacgctgaatcggctgctgatgcatcacatacgcgactgcctg
cccgatcttaagacacgtgttaacataatgtccacacaattccaatcgctgctgaattcc
tacggcgaggacgtgtcggacaagagccagacgttgttgcacatcataacgaagttctcc
agcgcctactgctccacgattgagggcaccgcgcggaatatcgagacgacagagctgtgc
ggcggcgcgcgcctctgttacatctttcatgagatctttgggcgcacactggactcgata
cacccgctggcaggcttgaccaaaatggacatcctgacagccatacgcaatgcaacgggt
ccgaggccggcgctgtttgtgcccgaggtctcattcgagctgctggtaaagcggcaaatc
cgacgcctagaggagccttcgctgcgctgcgtagagctcatacacgaggagatgcagcgc
attgtgcagcactgcggcaacgaggtgcaacaggagatgctgcgtttccccaagctacac
gaaaagattgttgatgtggtgacgcagctgttgcgttgtcgtctgcccgccaccaatgtc
atggtcgagaacattgtggccatcgaactggcgtacatcaataccaaacatcccgacttc
cacaaggaagccgcactggtgcccagcctacttaagaccgacagtgatcccttcgtacag
tcgcgccgaacgaatacgccacgtaatacaatgtcgccgcaggtctcctcccacaattcg
atgtcgcagagccaacaaccgtcacaacaactgctgcagacacaacagcaacagcagcag
caacaacaacaacagcagcagcaacaacaacagcagcagcagcaacaacagcagcaaaat
gatgcacatgagcaacagaatcacaacggcgataactcagcgggctcttggctgtcaaat
attttaccacccgcgcccaatcgtcccgatagcattgagaactcggctagcaatacgcca
gtgcataataatataactccactgaagccggtaaatctgctgcccgatgtgccgcagatg
gctaatccccgccgactcactgacaaggagcaaagggattgcgatgtgattgagcggctg
attaaatcttacttctatattgtgcgcaaatccatacaagactctgtaccaaaggcgatt
atgcactttttggttaactacgttaaggacaaccttcagagtgagctagtcacacacttg
tataagtcggataaggctgaaacacttctcaacgagtcggatcacattgcagtgcgccga
aaagaggcggcggatatgttgaaggcgctcactcgtgcgaatcatattataagcgaaata
cgagagactcacatgtggtag

DBGET integrated database retrieval system