KEGG   Drosophila mojavensis: Dmoj_GI23594
Entry
Dmoj_GI23594      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
Organism
dmo  Drosophila mojavensis
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase WSC fn3 PTP_tm
Other DBs
NCBI-GeneID: 6572405
NCBI-ProteinID: XP_001998514
FlyBase: FBgn0146320
UniProt: B4K504
LinkDB
Position
Unknown
AA seq 802 aa
MHRGHRPNASWQQQLASAYLVAICLLSNYVCVSAQDTQDLLTAEPVYYYVGCYTARTDLL
KESVYAKMPQTCIEICERQGHRYAVLAAEKCFCANHLEPQEKQDDQLCYTRCLANKAQYC
GGVGVHSYYSTTLLRQPAPHHLRVVNSTENSISLAWDAYEAKKLLLAGTAEALAAQTQEV
ANILIKCQIVQTYSTLPAFLQPEFIVQSTETRFELTDLHPATLYNISVRAICVQPQQEES
ECGHGSLMASTEVGTPSPAPAQPKVLSRTKDSITVELAPIKNDNGPVTKLLIIVEFVDDA
LIQPFDAQLLGSWQLAQQTGVPYYIAAELDYDRPEDNRTRHFVVGDGKRYGRYHNVPLDQ
MSNEQDKSAHVHISLGVVSTLRNVTKTLYTRSSHAQHASSLDDFSYATFEKGQSSVVALA
VTCVVFGTCLILSLITYFYLRYKTCHARGLTGRRRNAHEMTQQTPIIERENNGYLVEDEL
PPTLESFKQQFQMTIEGMEKLPRNSLRLNANDVIADGRYGEIITGRLSQGDAVKDCALHV
LSLDDLSGVSQAQLLREMRHLKQLRRHELVLDFYGISASADWFYLIFELQRVSLKRRLIE
SRQPAPAPRLTTLSEQLVLQWMYELTSAMSYLGSCQVHHRQLSGYSVYVCADSKLKLSVF
GPLHYVNSNGQQVDLGRWLAPEVLRHQHYTTMSDVWSFACVAWECCALGGTPYANIASSQ
QLLEAIRSGVRPAQPAYVYGDLFQLLLNCWQLEPSERIGFEDVAFGIRQLMTSPRHALCF
DRSASDPRETLPLYLPMLETIN
NT seq 2409 nt   +upstreamnt  +downstreamnt
atgcatcgtggacaccgcccaaacgctagctggcagcagcagcttgcatctgcgtacctc
gtggccatttgcttgctgtccaactatgtttgcgtgtccgcgcaggacacgcaggatttg
ctgactgcggagcccgtctactattatgtgggctgctatacggcccgcacggacctgctc
aaggagtcggtgtacgcgaagatgccgcaaacatgcatcgagatctgtgagcgccaggga
cacaggtacgcggtgctggctgccgagaagtgcttttgtgccaatcatctggagccgcag
gagaagcaggacgatcagctctgctacacccgatgcctggccaataaggcgcagtactgc
ggcggcgtgggcgtacattcgtactattccacaacgctgctgcggcagccagcaccgcat
catctgcgcgtggtcaacagcaccgagaacagcatcagcctggcttgggatgcatacgag
gcgaagaagctgctgctggccggcaccgcagaggcgctcgcggcccaaactcaggaagtg
gccaacattctaatcaagtgccagattgtccagacctactcaacgctgcccgcattcctg
cagcccgaattcatagtgcagagcacggagacccgctttgaactgaccgatcttcatccg
gcaaccctctacaacatcagcgtgcgcgccatttgcgtgcaaccgcagcaagaggaaagc
gagtgcggtcatggctcccttatggccagcactgaggtcggcacacccagtccagctcct
gcacagcccaaggtgctaagccgcaccaaggacagcatcaccgtggagctggcacccata
aagaacgacaacggaccggtaacgaagctactgatcattgtggagtttgttgacgatgcg
ctgatccagccatttgatgcacaactgctgggcagctggcagctggcgcagcagacagga
gttccgtactacatagccgccgagctggactacgaccggccggaggataatcgcaccagg
cactttgtagtgggcgatggcaaacgctacgggcgctatcacaatgtgcccctggatcag
atgtccaatgagcaggacaagtctgcccatgtgcatattagcttgggtgtggtgagcaca
ctccgaaacgtcaccaagacgctatacacgcgcagcagccatgcacagcatgccagctcc
ttggatgacttcagctatgccacctttgaaaagggtcaatcgtcggtggtcgccctggcc
gttacctgcgtcgtctttggcacctgcctgattctcagtctcattacctacttttacttg
cgctataagacctgccatgcgcgcggactgaccggacgcaggcgcaacgcccacgaaatg
acgcagcagacgcccatcatcgagcgggagaacaacggatatttggtggaggacgagctg
ccgcccacgctggagagcttcaagcagcagtttcagatgacgatcgagggcatggagaaa
ttgccacgcaattctcttcgactgaatgctaatgatgtcattgctgatggccgctacgga
gagattatcacaggacgactcagccagggtgacgccgtcaaggattgtgcgcttcacgtg
ctgtcgctggacgatctgtccggcgtgtcgcaggcacagctgctgcgcgagatgcggcac
ttgaagcaattgcgccgccacgaactagttctagatttctatggaatttcggccagcgct
gactggttctatctgatctttgagctgcagcgagtgagcctcaagcggcgcctgatcgag
agccgccagccagcacctgcgccacgcctgacaacactatcggagcaactggtgctgcag
tggatgtacgagttgaccagcgccatgtcgtatttgggcagctgccaggtgcatcaccgg
cagctgagcggctacagcgtttacgtgtgcgccgactccaaactcaagctgtccgtcttt
ggaccgctgcactacgtgaacagcaatggccagcaggtggatcttggccggtggctggcg
cccgaggtgctgcgacatcagcactacacgaccatgtcggacgtttggtcctttgcctgc
gtggcttgggagtgctgcgcactgggcggcacgccctacgccaacatagccagcagtcag
caattactggaggcaatacggtcgggcgtgcgtccggcgcagcccgcctatgtctacggc
gacctgttccagctgctgctcaactgctggcagctagagcccagcgagcgcatcggcttc
gaagatgtcgctttcggcatacgtcagctgatgacatcacccaggcacgcactttgcttt
gatcgctctgcttcagatccgcgggagacgctgccgttgtacctgccgatgcttgagact
atcaactag

DBGET integrated database retrieval system