KEGG   Drosophila mojavensis: Dmoj_GI24705Help
Entry
Dmoj_GI24705      CDS       T01062                                 

Gene name
Dmoj_Mal-B1
Definition
(RefSeq) maltase B1
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00052  Galactose metabolism
dmo00500  Starch and sucrose metabolism
dmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Dmoj_GI24705 (Dmoj_Mal-B1)
   00500 Starch and sucrose metabolism
    Dmoj_GI24705 (Dmoj_Mal-B1)
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Dmoj_GI24705 (Dmoj_Mal-B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase DUF4464
Motif
Other DBs
NCBI-GeneID: 6577037
NCBI-ProteinID: XP_002003012
FlyBase: FBgn0147427
UniProt: B4KIU8
LinkDB All DBs
Position
Unknown
AA seq 586 aa AA seqDB search
MAWKLLKLALCLCWLLAETQADSAKDKKAKEVDDNWWRHEVFYQIYPRSFKDSNGDGIGD
LKGITSKLPYFVETGITAIWLSPIYSSPMVDFGYDISDYRDIYPDYGTLDDFDELIATAN
QLGIKVILDFVPNHSSDKHEWFKKSAARVSGYEDFYVWEDGTEENGERKPPNNWVSVFSG
SAWQWHEERKQFYLRQFTKGQPDLNYRNPAVLQAMDAVLTYWLKRGVSGFRIDAVNYVFE
DKQLRDEPLSGATSDPNSVDYLNHIYTRNQEENYGLIQHWRKLLDDYSEKYGGPARIMMT
EGYAELPQVMEFYEDENGVQGANFPFNFDFITELNSESTAQDFVFTIQRWLIYMPPGHSA
NWVMGNHDNPRVASRYGAKSVDAMNMLLMTLPGIGITYNGEELGMEDYRDISFEDTVDQP
ACEAGKDNYKWISRDPERTPMQWSDEKNAGFSTADSTWLPVHPNYQELNLANQQLAPSSH
YKVYQSLIKLRSSKVLKDGTYTAQALNRRVFALKRELRGQPSLLTVINVSNRTQQVDVSD
FIDLPNRLTLLVVGVNSQYRVGERLKPDEIRLTPYEGLVIQLKPSK
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggcttggaaactattgaaattagcgctttgcttgtgctggctgcttgccgagacgcaa
gcagattcggcaaaggataagaaggcaaaggaggtggacgacaactggtggcgtcatgag
gtcttttatcagatctatcccagatccttcaaggacagcaatggcgatggcattggcgat
cttaagggcatcacctcaaagctgccatactttgtggagaccggcatcacggccatttgg
ctgagtcccatttactcgtctcccatggtggacttcggttacgatatatctgactaccgg
gacatttatccggactacggtactttggatgactttgatgaactgattgccaccgccaat
cagctgggaattaaggtcattcttgactttgtgcccaatcacagctctgacaaacatgaa
tggttcaaaaagtccgctgctagagtctcaggctacgaggatttctatgtgtgggaagat
ggaactgaagagaatggtgaacgcaagccgcctaacaattgggtatccgtgttctctggc
tccgcctggcagtggcacgaggagcgaaagcaattttatctgcgtcaattcaccaaggga
cagcccgatctgaactatcgtaatcctgctgtgctgcaggccatggacgctgtgctgact
tactggctgaaacggggcgtgtcaggtttccgtatagatgccgtcaactatgtctttgaa
gataaacagctgcgcgacgagcccttgagcggagccacaagcgatcccaactccgttgat
tatctgaatcatatctacactagaaatcaagaggaaaactacggcctaattcagcattgg
cgcaaactgctcgatgactattcggaaaaatatggaggtccagcgcgcattatgatgacc
gagggctatgcggagctgccgcaagtaatggagttctatgaggacgagaatggcgtgcag
ggcgccaacttccccttcaacttcgactttataaccgagctgaactccgagtcgacggct
caggactttgtcttcactattcagagatggttgatctacatgccgccaggacactcagcc
aactgggtgatgggcaatcatgacaatccacgcgttgcctccagatatggtgccaagtcg
gtcgacgccatgaacatgctcttgatgactctaccgggcattggcattacctacaatggt
gaggagctgggtatggaggactatcgtgacattagctttgaggacacagtggatcagccc
gcatgtgaagctggtaaggataactacaagtggatttcacgagatcccgagcgcacgcca
atgcagtggagtgatgagaagaatgccggcttctccacggccgattccacctggttgcca
gtgcatcccaactatcaggaattgaatctagccaatcagcagttggcaccgtccagtcac
tataaggtctaccagtccctgatcaagttgaggagctctaaggttctaaaggacggtaca
tatactgcccaggctctcaatcgacgtgtttttgcactcaagcgcgagctgaggggccag
cccagcctgttgaccgtcataaacgtgagcaatcgcacccagcaggtggatgtcagcgac
tttatcgatttacccaatcgccttaccctcctggttgtcggtgtcaattcccagtacaga
gtgggcgaacgtctcaagccagatgaaatcaggctgacaccctacgaaggtttagttata
cagcttaagcccagcaagtaa

DBGET integrated database retrieval system