KEGG   Deinococcus maricopensis: Deima_0025Help
Entry
Deima_0025        CDS       T01412                                 

Definition
(GenBank) Enoyl-(acyl-carrier-protein) reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
dmr  Deinococcus maricopensis
Pathway
dmr00061  Fatty acid biosynthesis
dmr00780  Biotin metabolism
dmr01100  Metabolic pathways
dmr01130  Biosynthesis of antibiotics
dmr01212  Fatty acid metabolism
Module
dmr_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:dmr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Deima_0025
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Deima_0025
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Deima_0025
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dmr01004]
    Deima_0025
Enzymes [BR:dmr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Deima_0025
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Deima_0025
Lipid biosynthesis proteins [BR:dmr01004]
 Fatty acid synthase
  Component type
   Deima_0025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase KR
Motif
Other DBs
NCBI-ProteinID: ADV65689
UniProt: E8U3Z5
LinkDB All DBs
Position
28459..29235
Genome map
AA seq 258 aa AA seqDB search
MNGKTALVMGVANARSLAWAIAEQLLAAGARVGFSYQGERLKGELDKLLVDKPGTWSMQA
DATSEADLAALMDRVKQEFGELDYVVHAIAFAPRAAMEGRFVETTPDDWNTALNVSAYTF
VAVARHAEPLLREGGSLITLTHHASQQVFPKYNVMGVAKAALEAATRYLASDLGAKGVRV
NAVSAGPARTVAARSIPGFGTMFEEAGKASALRRNITNDEVGKLGLYLLSDLASGVTGQT
VYVDAGAYIMAMKPQGTE
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcaagacggcgctcgtgatgggcgtcgcgaacgcccgcagtctcgcgtgggcg
attgcggagcagctgctcgcggcgggcgcgcgcgtgggcttcagctatcagggggagcgc
ctgaagggcgaactcgacaagctcctcgtggacaaaccgggcacgtggagcatgcaggcg
gacgccaccagcgaagcggacctcgcggcgctgatggaccgcgtgaagcaggagttcggt
gaactggactacgtggtgcacgccatcgcgttcgcgccgcgcgcggccatggaaggccgc
ttcgtggaaacgacgccggacgactggaacacggcgctgaacgtcagcgcgtacactttc
gtggcggtcgcgcgacacgccgaacccctgctgcgcgagggcggcagcctgattaccctc
acgcaccacgccagccagcaggtgttcccgaagtacaacgtcatgggcgtcgcgaaggcc
gcgctggaagccgccacccgctacctcgcctcggacctgggcgcgaagggcgtgcgcgta
aacgccgtgagcgccggcccggcccgcaccgtggcggcgcgcagcattcccggcttcggc
accatgttcgaggaagctggcaaggccagcgccctgcgccgcaacatcaccaacgatgag
gtcggcaagcttgggctgtacctgctgtccgacctcgccagtggcgtgaccggccagacc
gtgtacgtggacgccggcgcgtacatcatggccatgaagccgcaggggaccgagtaa

DBGET integrated database retrieval system