KEGG   Deinococcus maricopensis: Deima_0786Help
Entry
Deima_0786        CDS       T01412                                 

Definition
(GenBank) Malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
dmr  Deinococcus maricopensis
Pathway
dmr00020  Citrate cycle (TCA cycle)
dmr00270  Cysteine and methionine metabolism
dmr00620  Pyruvate metabolism
dmr00630  Glyoxylate and dicarboxylate metabolism
dmr00680  Methane metabolism
dmr01100  Metabolic pathways
dmr01110  Biosynthesis of secondary metabolites
dmr01120  Microbial metabolism in diverse environments
dmr01130  Biosynthesis of antibiotics
dmr01200  Carbon metabolism
Module
dmr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dmr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dmr_M00012  Glyoxylate cycle
dmr_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Deima_0786
   00620 Pyruvate metabolism
    Deima_0786
   00630 Glyoxylate and dicarboxylate metabolism
    Deima_0786
  09102 Energy metabolism
   00680 Methane metabolism
    Deima_0786
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Deima_0786
Enzymes [BR:dmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Deima_0786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C
Motif
Other DBs
NCBI-ProteinID: ADV66442
UniProt: E8U5V3
LinkDB All DBs
Position
876325..877311
Genome map
AA seq 328 aa AA seqDB search
MKQPVRVAVTGAAGQIGYSLLFRIAAGDMLGKDQPVILQLLEITPALKALQGVVMELRDC
AFPLLADIVTSDDPKVAFKDADYALLVGAMPRKAGMERGDLLSANGGIFKPQGEALAEVA
SRNVKVLVVGNPANTNALIAQQNARGLDPKQFTAMVRLDHNRAISQLAERTGKPVSSIKN
LTIWGNHSSTQYPDLAHATVDGQPALEAVNDQAWYENEYIPTVAKRGAAIIEARGLSSAA
SAASAAIDHMRDWALGTADGEWVSMGIPSDGSYGIPEGLIYGFPVTVKNGEYTIVQGLDV
SDFSRGKMDATAQELEEERQAVRDLGLI
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacctgtacgcgtcgccgttaccggcgctgccggccagatcggctacagcctg
ctcttccgcatcgccgcgggcgacatgctcggcaaggaccagccggtcatcctgcaactc
ctcgaaatcacgcccgccctcaaggccctgcagggcgtcgtgatggaactccgcgactgc
gcgttcccgctcctcgcggacatcgtcaccagcgacgaccccaaggtcgcgttcaaggac
gccgactacgcgctgctcgtcggcgccatgccccgcaaggccggcatggaacgcggcgac
ctgctgagcgccaacggcggcatcttcaaaccccagggtgaagcgctcgccgaagtcgcc
agccgcaacgtcaaggtcctcgtcgtcggcaaccccgccaacacgaacgccctcatcgcg
cagcagaacgcccgcggcctggaccccaagcagttcacggccatggtgcgcctcgaccac
aaccgcgccatcagccagctcgccgagcgcaccggcaagcccgtgagcagcatcaagaac
ctcaccatctggggcaaccacagctccacgcagtacccggacctcgcccacgccaccgtg
gacggccagcccgccctcgaagccgtgaatgaccaggcgtggtacgagaacgagtacatc
cccacggtcgccaagcgtggcgccgccatcatcgaggcgcgcgggctcagcagcgccgcg
tccgccgcgagcgccgccatcgaccacatgcgcgactgggcgctcggcacggctgacggc
gagtgggtcagcatgggcatccccagcgacggcagctacggcatccccgagggcctgatc
tacggcttccccgtcaccgtcaagaacggcgagtacaccatcgtgcagggcctcgacgtc
agcgacttcagccgcggcaagatggacgcgaccgcgcaggaactcgaagaagagcgccag
gctgtgcgcgacctcggcctgatttaa

DBGET integrated database retrieval system