KEGG   Deinococcus maricopensis: Deima_2073Help
Entry
Deima_2073        CDS       T01412                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dmr  Deinococcus maricopensis
Pathway
dmr00620  Pyruvate metabolism
dmr00680  Methane metabolism
dmr01100  Metabolic pathways
dmr01120  Microbial metabolism in diverse environments
dmr01200  Carbon metabolism
Module
dmr_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Deima_2073
  09102 Energy metabolism
   00680 Methane metabolism
    Deima_2073
Enzymes [BR:dmr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Deima_2073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ADV67716
UniProt: E8U9H7
LinkDB All DBs
Position
complement(2246136..2248616)
Genome map
AA seq 826 aa AA seqDB search
MGIREDVNTLGRALGQVLKEQEGEAFFDTVERVRALVRQARAGDGDAPLRELLEGATPED
AENLVRAFSLYFQLVNLAEEYERVRTLAGREGVRPQSLEAALTELHASGLSADDAEALIQ
RVNLGLTFTAHPTEMRRRTVRAHLVQVARDIPDLSDPTTYDAAVERITAHVEALWNTPEL
RRLKPTVLDEVKGGLSYVPSIAQAVTRLQRDLQRAFERVYGRPTSARVPLSLHSWMGGDR
DGNPFVTPDATRDTLTLHRDRARDLLLNAIRQTYADLSQDERGEETYRAELQALHDAVQA
GQHVDLTAQLDALDARLREHGQARSADVLLAPLRTHARTFGQHLVSLDIREHSALTGAAA
AALLDAAGMPGYADLPEHAKTELLTRELRSRRPLWPAGEALPEELERAVGPIREVARAVR
KVGPRAFGRYIISMSESVSDVLEPLLLAREVGFRVLPVPLFETLDDLERAPSVVWELLSL
PEYRAVLGSDVQEIMLGYSDSNKDAGFLAANWALHEAQRRLADVCRRAGVPWRFFHGRGT
SIGRGGGPASRAILGQPAGTIGSGLRITEQGEALADKYSHPVLAHRNLEQALSGLLLAAA
RPAADLPAAWTEALDRAARASAGAYRALVTTPEFLPFFEAATPIHEISRLNIASRPVRRP
GAPTLQNLRAIPWVMSWTQNRANLPGWYGLREGLREIGVPLARELYAQWPFFRSMLDNAQ
MSLAKSDLLIFDEYLTLGGPALGPDLKAAYADTVALVQDIVGADLLRNEPRLHESIGLRN
PYIDPIHRLQVELLRRARREDGGLDRYERPLLLSVQGIAAGVRNTG
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atgggcatacgagaagacgtgaacaccctcgggcgcgcgctcgggcaggtcctcaaggaa
caggaaggcgaggcttttttcgacaccgtggagcgcgtccgcgcgctcgtccgccaggcg
cgcgccggcgacggcgacgcgcccctgcgtgaacttctggaaggcgccacccccgaggac
gccgagaacctcgtgcgcgccttcagcctgtacttccaactggtaaacctcgctgaggag
tacgagcgcgtccgcaccctcgccggccgcgaaggcgtccgcccgcagagcctcgaagcg
gccctgaccgaactgcacgcgagcggcctgagcgccgacgacgccgaagcactgattcaa
cgcgtgaacctcggcctcaccttcaccgcccacccgaccgagatgcgccgccgcaccgtc
cgcgcgcacctcgtgcaggtcgcgcgcgacattcctgacctcagcgaccccaccacgtac
gacgcggctgtggagcgcatcaccgcgcacgtggaagcactgtggaacaccccggaactc
cggcgcctgaaacccaccgtcctcgacgaggtcaaaggcggcctcagctacgtgcccagc
atcgcgcaggccgtcacgcgcctgcaacgtgacctgcagcgcgccttcgagcgcgtgtac
ggacgccccacgagcgcgcgcgtgccgctcagcctgcactcctggatgggcggcgaccgc
gacggcaaccccttcgtgacgcccgacgccacgcgcgacacgctcaccctgcaccgcgac
cgcgcccgcgacctgctcctgaacgccatccggcagacgtacgcggacctcagccaggac
gagcgcggcgaggagacgtaccgcgccgaactgcaggcgctccacgacgccgtgcaggcc
gggcagcacgtggacctcacagcgcagctcgacgccctcgacgcgcgcctgcgcgagcac
gggcaggcgcgcagcgcggacgtgctgctcgcgccgctccgcacgcacgcgcgcacgttc
gggcagcacctcgtcagcctcgatatccgcgagcacagcgccctcaccggcgcggccgcc
gctgccctcttggacgcggccggcatgcccgggtacgcggacctgcccgagcacgccaaa
accgaactgctcacgcgcgaactccgctcccgccgccccctgtggcccgccggtgaggcc
ctccccgaggagctggaacgcgcggtcggcccgatccgcgaggtcgcgcgggcggtccgc
aaggtcggcccgcgcgcgttcgggcggtacatcatcagcatgagcgaaagcgtcagtgac
gtcctcgagccgttgctgctcgcccgtgaggtcgggttccgcgtgctgcccgtcccgctg
ttcgagacgctcgacgacctggagcgtgcccccagcgtcgtctgggaactcctgagcctc
cccgagtaccgcgccgtgctcggcagcgacgtgcaggaaatcatgctcgggtacagcgac
agcaacaaggacgccggcttcctggccgccaactgggcgctgcacgaagcgcagcgccgc
ctcgcggacgtgtgccgccgcgcgggcgtcccgtggcgcttcttccacgggcgcggcacc
agcatcggccgcggcggcggccccgccagccgcgccattctcgggcagcccgccggcacc
atcggctccggcctgcgcatcaccgagcagggcgaagcgctcgccgacaagtacagccac
cccgtcctcgcgcaccgcaacctggagcaggccctctccgggctgctgctcgccgccgcg
cgtcccgccgcggacctgcctgccgcgtggaccgaggcgctcgaccgggccgcgcgcgcc
agcgccggcgcgtaccgcgcgctcgtcaccaccccggaattcctgccgttcttcgaggcc
gccacgcccatccacgagatctcccgcctgaacatcgcctctcggccggtgcgtcgcccc
ggcgcgcccaccctgcagaacctccgcgcgatcccctgggtgatgagctggacgcagaac
cgcgcgaacctgcccggctggtacggcctgcgcgagggcctgcgcgagatcggcgtaccg
ctcgcccgcgagctgtacgcgcagtggccgttcttccgcagcatgctcgacaacgcccag
atgagcctcgccaagagcgacctgctgatcttcgacgagtacctgacgctcggcgggccc
gcgcttggcccggacctcaaggccgcgtacgcggacaccgtcgcgctcgtgcaggacatc
gtcggcgcggacctgctccgcaacgaaccgcgcctgcacgaaagcatcgggctgcgcaac
ccctacattgaccccatccaccgcctgcaagtggaactgctgcgccgcgcgcgccgtgag
gacggcggcctcgaccgctacgagcgccccctgctgctcagcgtgcagggcatcgccgcg
ggcgtccgcaacaccggctga

DBGET integrated database retrieval system