KEGG   Desulfitobacterium metallireducens: DESME_01150Help
Entry
DESME_01150       CDS       T03599                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dmt  Desulfitobacterium metallireducens
Pathway
dmt00030  Pentose phosphate pathway
dmt01100  Metabolic pathways
dmt01120  Microbial metabolism in diverse environments
dmt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dmt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DESME_01150
Enzymes [BR:dmt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     DESME_01150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AHF05840
UniProt: W0E4Q5
LinkDB All DBs
Position
242488..244293
Genome map
AA seq 601 aa AA seqDB search
MGGYTGKILRINLTDRTSNTETLNLEMAKKYLGGRGLAGKMYTDEVATDVDPFSPDNKLF
IATGALTGTNAPTSGRFMVVTKSPLNSTLASSNSGGFWGPQLKFAGYDMLILEGAASTPV
YISIKDDQVEIKEADHLWGKDVYETSALLKQEFGDDQAKVLTIGPAGEKLSYMAAVMNDL
YRAAGRNGVGAVMGSKKVKGIIVRGTGKVENADPEGMKAVLTDVLKKIRENGVTGQGLPT
YGSAILVNIINENGVYPVNNFQESYDEDADKISGETMTDKHLIKKHPCYRCPIACGRYCK
WDEGEGEGEGAGPEYETVWVFGSDCGIHDYDAIHQANDLCNKYGLDTISVGGTIAAGMEL
FQRGYIKPEELGGTPLEFGNVAGMVEWVRKIAFAEGLGAKMALGSYRFAESYGAPELSMS
VKKQELPAYDPRGVQGQGLAYATNNRGGCHVRAYMISPEILGLPEKIDRFAIEGKAAWAK
IFQDLTGVIDSIGLCLFSSFALGLSEYTQLVNAVTGFGYSEEELLQCGERIWNNERLHNL
RVGYTKADDSLPKRLLDDPIVDGPSKGQVNRLEELLPEYYSVRGWDEEGVPTPEHLSALN
M
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgggcggttataccgggaaaattttacggatcaatttaacggatagaacgagtaatact
gaaactttaaatctagaaatggctaaaaagtacttgggtgggcgcggtctcgctggtaaa
atgtatacggatgaagtggcaacggatgtggatcccttttcacctgataataaactattt
attgctacaggtgcactgacgggaacgaatgcaccgacctcgggtcgttttatggtggta
acaaaatcccctcttaatagtacgttagcttcctcgaattccggaggattttggggaccc
caacttaagtttgcaggatacgatatgctcatcttagaaggggcagcatctactcctgtt
tatatctccattaaagatgatcaggtggagattaaggaagctgaccatctttggggaaaa
gatgtttatgaaacttcagcgcttctcaagcaagagttcggagatgatcaagcgaaagtc
ttaacaatcggtcctgccggtgagaagctatcctatatggctgcagtcatgaatgacctt
tatcgcgcagcaggacgtaatggcgtcggtgctgttatgggatccaaaaaggttaaagga
atcatcgtccggggtacaggaaaagtggaaaatgcagatcctgagggtatgaaagccgtt
cttactgatgtattgaagaaaattcgggaaaatggagttacaggccagggattgcctacc
tatggaagtgccatcttggttaatattattaatgaaaatggggtttatcctgttaacaat
ttccaagaatcgtatgatgaggatgctgataaaattagtggtgagacaatgacggataag
catctcattaaaaaacatccatgttatcgttgtcccattgcttgtggacgttattgtaaa
tgggatgaaggtgaaggagaaggcgaaggcgcgggtcctgagtatgaaacggtatgggtt
tttggttcggactgtggaattcatgactatgatgccattcatcaagcgaatgacctttgt
aataagtatggattagataccatttctgtagggggaacgattgcagccggaatggagtta
tttcaacggggatatatcaaacctgaggagttgggtggaactcctttagagttcggaaat
gtggcaggaatggttgagtgggttcggaaaatcgcttttgcggaaggtttaggcgccaaa
atggccttaggttcttatcgctttgctgaaagctatggtgctcccgagctatcgatgtca
gttaaaaaacaggagcttccggcatatgatccacgcggtgtacaagggcaaggattagcg
tatgcaacgaataatcgtgggggatgccatgtccgcgcatatatgatttcgccggagatc
cttgggcttcctgaaaaaattgatcgtttcgcgattgagggaaaagcagcttgggccaag
atttttcaggatcttactggagtcattgattcaattggtctttgtctcttctcttccttt
gccctggggctatcggaatatacccaacttgttaatgctgtgacagggttcggttattct
gaagaagagcttctgcaatgtggagaacgaatttggaataacgaacgccttcataatttg
cgtgtgggttatacgaaagcagatgacagtctacccaaacggttacttgatgatccgatt
gtagatggaccttccaagggacaggttaatagactcgaagaactcttgccggagtattat
agtgttcgcgggtgggatgaagagggagtgcctactcctgagcatctcagtgccttgaac
atgtaa

DBGET integrated database retrieval system