KEGG   Desulfitobacterium metallireducens: DESME_04710Help
Entry
DESME_04710       CDS       T03599                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
dmt  Desulfitobacterium metallireducens
Pathway
dmt00970  Aminoacyl-tRNA biosynthesis
dmt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmt00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DESME_04710
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dmt03029]
    DESME_04710
Enzymes [BR:dmt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     DESME_04710
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     DESME_04710
Mitochondrial biogenesis [BR:dmt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DESME_04710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AHF06439
UniProt: W0EB41
LinkDB All DBs
Position
941309..942763
Genome map
AA seq 484 aa AA seqDB search
MSILDRYEMVCGVEVHVELATKTKIFCNCSTEFGGEQNTHACPVCLALPGTLPVLNRGVV
NLAIKAGLALNCEIAEFSKFDRKNYFYPDSPKNYQISQYDLPICKQGWVDIEVDGEKRRI
GITRAHMEDDAGKLVHSGETISTSSESAVDYNRTGVPLLEIVSEPDMRSIPEVLAFLEEL
VKIMQYTEVSDCRMEQGSIRFDINVSLRPWGQKEFGTRTESKNLNSFSSVRRCLEYEIGR
QAELLDDGDEVIQETLTWDEGRGITLSLRSKEEAHDYRYFPEPDLPPLVIDREWVENVRQ
ALPELPAARRERLKSLGLSDYDAGVITNTKALSDFFDEAMKRYADAKNLANWTMGEYTRL
LNAQGVSVEESPVKPQQLATLLGLIDKGTISGKIGKTVIEEMFASGKDPEVIIKEKGLAQ
ISDEGALLKIVDEVIAKNPQSVEDYKAGKTQAIGFLVGQTMKATKGQANPGVVNNLLKER
LALQ
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagtatattagatcgttatgaaatggtttgcggagtcgaagtccatgtggagctcgcg
accaaaacaaagattttctgtaattgcagcacagaatttggcggcgagcaaaatacgcat
gcctgcccagtttgtttggctttaccaggaactctgccggtgcttaatcggggcgttgtg
aatcttgcgattaaagcaggacttgcgttaaactgtgaaattgctgagttttccaagttt
gataggaagaattatttctatcctgattccccgaaaaattatcagatttcacaatatgac
ttaccaatttgcaaacaaggttgggtcgatattgaagtcgatggcgaaaagagaaggatt
gggattacccgtgcccatatggaagacgatgcaggcaagctcgtacacagtggagaaacg
atttcaacttcctctgaatcggctgtggactataacaggactggcgttccccttcttgag
atcgtttccgaacccgatatgcgctcgatccctgaagttttggccttccttgaagaattg
gtgaagatcatgcaatatacggaagtctctgactgtcggatggagcaaggctcaattcgt
tttgatatcaatgtttccctaagaccatgggggcaaaaggaattcgggacccgtacagaa
tcgaagaatttgaattcatttagttcagttcggcgctgtctagagtatgagatcggtcgt
caagctgagcttctggacgacggggacgaagttattcaagagacgttgacctgggatgaa
ggacgaggaattaccttatccctccgttctaaagaggaagctcatgattatcgctacttt
ccagaacctgatctacctccgctcgtcatcgatcgggagtgggtcgaaaacgttcgtcaa
gccctgcctgaactgcctgctgcccgcagagaacggcttaaatcccttggcttatctgat
tatgatgcaggcgtaattacgaatactaaagcgctttctgacttttttgatgaagccatg
aagcgttatgctgatgctaaaaatctggcgaactggacgatgggggaatatacacgtctc
ctcaatgctcaaggggttagtgttgaagaatctccagttaagccacaacaactggcaacg
ctccttggactaattgataaaggaacgattagtggtaaaatcgggaaaactgtgattgaa
gagatgtttgcttcagggaaagatccagaagttattatcaaagaaaaaggcctagctcaa
atcagtgatgaaggcgccttactcaaaatcgtcgatgaagtgattgctaaaaatcctcaa
tcagtcgaagattacaaggcaggaaaaacacaggcgattggcttcctcgttgggcagacg
atgaaagcgacaaaagggcaggctaatcccggtgttgtcaacaacctgctgaaggagcgt
ctggctctacagtag

DBGET integrated database retrieval system