KEGG   Desulfitobacterium metallireducens: DESME_11900Help
Entry
DESME_11900       CDS       T03599                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dmt  Desulfitobacterium metallireducens
Brite
KEGG Orthology (KO) [BR:dmt00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dmt01001]
    DESME_11900
Enzymes [BR:dmt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     DESME_11900
Protein kinases [BR:dmt01001]
 Serine/threonine kinases: Other
  Bacterial family
   DESME_11900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kdo APH RIO1 Borrelia_P13 YrbL-PhoP_reg Kinase-like Pkinase_fungal PIP49_C
Motif
Other DBs
NCBI-ProteinID: AHF07634
UniProt: W0EEJ8
LinkDB All DBs
Position
complement(2329948..2331639)
Genome map
AA seq 563 aa AA seqDB search
MSKVLSDRYEIIEKIGVGGMAIVYKAKDLLLNRVVTIKVLREQFASDDDFVRRFRREAQS
AASLSHPNIVSIYDVGKDGDTEYIVMEYVEGQNLKELIRNYAPLSSEQSINLARQIAEAI
RHAHEHHIIHRDIKPHNILVTADGRAKVTDFGIARAVSAATMTHTGDIIGSVHYLSPEQA
KGVQTNEQSDLYSLGIILYELLTGKVPYDGETPVAIALKHLQENPVPPSQLNPRISQGIE
NVILKAIAKAPERRYQTAVEFVEDLNHIQNGEPIRKIERPLEEDLDSTRIHKSLSNGVNA
ALSAYSKDEEPKPNQPQKKRKRWIWVTAAVILLLIGVIGFGFRNYIGGGTTKVPNFVGHT
VIEAGFMAEKSNLKLDSNPPAEEYSDTVEKGKISSQDPVADTLVKDGRTIKIWVSKGPEM
LKMPNLKTGKMTEEDAKNALKTARFTGDVNVTQDTTSNLPAGIVVGQNPPADILWAKNGK
IDLQVSAGTFNNNQVMPNLVGKSVTEAQNILVNQMNLKVVIVKESSTEYPKEAVMATNPK
PGDPIPPGTVITITVSDGPGPLA
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagtattaagcgatcgctacgaaattattgaaaagatcggagtcgggggaatg
gctattgtctataaggccaaggacctcctgcttaatcgtgttgtgacgattaaagttctt
cgcgagcaatttgcatcagatgatgattttgtacgtcgttttcggagagaggctcagtcg
gctgctagtctttctcacccgaatatagtctcgatttatgacgtgggcaaagacggggat
acagaatatattgtgatggagtatgttgaagggcaaaatcttaaggaactcatccgtaat
tatgcgcccttgtcgtctgaacagagtattaatttggcgagacaaatcgccgaagcgatc
cgtcatgctcatgagcaccacattattcatcgggatattaaacctcataatattcttgtg
actgcagatggacgagcaaaagtaacggacttcggaatcgcaagagcagtttctgcagcg
acgatgactcatactggagatataattggctctgttcattatctatcacctgaacaggct
aaaggagttcagaccaatgagcaatcggatctatactctctgggaattatactctatgag
ttattaacggggaaagttccttatgatggagaaactccggtcgctattgcgcttaaacat
cttcaagaaaatccagttcctccgagtcagctgaatccaaggattagccaaggaatcgaa
aatgtaatcctcaaggcaattgctaaagccccagagcggcgctatcaaaccgctgtagaa
tttgttgaggatttaaaccatatccaaaatggagaaccgattcgtaagatagaaagacca
ctcgaggaagatctagacagcactcgtattcataagtccttaagtaatggagtgaatgca
gccttatcagcttattcaaaagatgaggaaccgaagccaaatcagcctcagaaaaaacgt
aaaagatggatttgggttacggcagccgtcatcctgcttctaatcggcgtaatcgggttt
gggtttagaaattatattggtggaggaacaacgaaagttccgaattttgtcggtcatacg
gttatcgaggcagggttcatggcggaaaaatcaaatttgaaactcgattcgaatccgccg
gcggaagagtatagcgatacggtagagaaagggaaaatcagtagtcaagatccagttgcc
gatacactagtcaaagatggacgaaccattaaaatttgggtgagtaaaggaccggaaatg
cttaagatgcctaatctgaagaccggtaagatgactgaggaagacgccaaaaatgcactt
aagactgctcgctttacaggggatgttaacgttactcaagatacgacctcaaatttacca
gcagggattgtcgtaggacaaaatcctcctgcagatattctttgggctaagaatggaaag
attgatctgcaagtgagcgcaggaacattcaataataaccaagtgatgcccaatttggtg
ggtaaatccgtaacagaagcacagaatattttagttaatcaaatgaatttaaaagttgtg
attgtcaaagagagttcaactgaatatccgaaagaggcggttatggcgacaaatcccaaa
ccaggggatccaatcccgcccggtacggttataaccatcacggtgtcggatggccccggg
ccattggcttaa

DBGET integrated database retrieval system