KEGG   Desulfitobacterium metallireducens: DESME_13540Help
Entry
DESME_13540       CDS       T03599                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
dmt  Desulfitobacterium metallireducens
Brite
KEGG Orthology (KO) [BR:dmt00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    DESME_13540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AHF07935
UniProt: W0EAN9
LinkDB All DBs
Position
complement(2657503..2658510)
Genome map
AA seq 335 aa AA seqDB search
MISTGALLVLVVFCALAFDFINGFHDTANAVATVISTRALSPKRAIIMSAGLNLLGALVS
TGVAQTIAKDIVSPEFATSEVVIAALIGAIAWNLVTWYFGIPSSSSHAIIGGMMGAAIAH
AGFSILHWNGLTKIVAALLISPVLGIIIGFIVMKILFFTFRNASPSKVNHGFHKLQILSA
AILSFNHGSNDAQKSMGIITLALIAAGMQASTNLNPPLWVKIGCALAMAAGTSTGGWRII
KTMGGKIFKLEPINGFAAELSASVVIWVATAFPGLHLPVSTTHVVSGAIMGVGSAKRVSA
VRWGVAQQMLTAWVVTIPSSALLAAMVFKLISLVI
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgattagtaccggtgctttgctcgttctcgtcgtcttttgtgctctggcctttgatttt
attaatgggtttcatgatacagctaatgcagttgctacggttatctcgactcgggcctta
agcccgaaacgagcgattatcatgtctgcaggtcttaatcttttaggggcacttgtgagt
acgggggtagcacaaaccatcgctaaagatattgtttctcctgaatttgcaacttcagag
gttgtcattgccgcattgataggagcgattgcatggaatttggtgacgtggtacttcgga
atcccaagtagttcatctcatgccatcatcggtgggatgatgggagctgcgattgcccat
gcaggattcagtattttacattggaacggtctaacaaaaattgtggcggctcttcttatc
tctccagttttaggtattattatcggttttatcgtgatgaaaattctcttttttacgttc
cgtaatgcatctccttcgaaagttaatcatggttttcataaattgcaaattctctcagct
gccattctttcgtttaaccatggttcgaatgatgctcagaaatcgatgggaattatcacc
ttggcccttattgctgctggaatgcaagcttcaacaaacttgaatccaccgctttgggtt
aagattggctgcgctttagctatggcagcgggaacttcaaccggaggatggcgaatcatt
aagacaatgggtggcaaaatttttaaacttgagccgatcaatggttttgctgcggagtta
agtgcttccgttgttatttgggtagcgacagcttttccaggtttacaccttccggtttcg
acaactcatgttgtttctggtgctatcatgggagttggaagtgccaaacgggtttcggct
gttcggtggggggttgcgcagcaaatgcttaccgcctgggttgtcacgattcccagttcc
gctttgctggcagcaatggtatttaaattaatttctctcgtgatatga

DBGET integrated database retrieval system