KEGG   Dehalococcoides mccartyi CG1: X792_06245Help
Entry
X792_06245        CDS       T03647                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
dmx  Dehalococcoides mccartyi CG1
Pathway
dmx00970  Aminoacyl-tRNA biosynthesis
dmx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    X792_06245
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dmx03029]
    X792_06245
Enzymes [BR:dmx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     X792_06245
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     X792_06245
Mitochondrial biogenesis [BR:dmx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    X792_06245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AII58288
UniProt: A0A076IB61
LinkDB All DBs
Position
1121542..1123002
Genome map
AA seq 486 aa AA seqDB search
MTDLIKLTIAQSHKLLKERKLSSAELTQAHLDRIEKLEPEIKAFMTVCPESALAQAKAAD
ETIKQGHIRPLTGIPMALKDVLCTKGIRTTCSSKMLENFVPPYNAHVVDKLAEEGAVLLG
KTNMDEFAMGSSTENSAFFTTRNPWNTAKVPGGSSGGSAACVAASEAVFSLGSDTGGSIR
QPASFCSVTGLKPSYGMVSRYGLVAFASSLDQIGPFTKDVLDCALVMNAIAGFDDRDSTS
VPQAVPDFSSCLDGDIKGFKLGVPKEYFSQNMRADIAEKINDALSVLSGLGASVDHEVSL
PHTPYALAVYYILAPSEASANLSRYDGVKYGYSYNQTENMWEAMEKTRAKGFGPEVKRRI
MIGTYALSAGYYDAWYVKAQKVRTLISQEFNNAFEKYDALITPTTPNLPFSVGEKLNDPF
EMYMCDTCTIPINIAGLPAISIPAGFVDGLPVGLQIIGKPFADQTIMRIAHAFQCATAWH
KETPRL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgacagatttaatcaagctgaccattgcccagtcccataaactgctgaaagaacgaaag
ctatcttccgccgagcttacccaagcccatctggacaggatagaaaaacttgagcctgag
ataaaggcttttatgactgtctgccctgagagtgctttagcccaggctaaagcggctgac
gaaactataaaacaggggcatatccgcccgctgaccggtatccccatggcccttaaagat
gtattatgcaccaaaggtatccgcaccacctgttcctccaagatgctggaaaactttgtg
cccccgtataatgcccacgtggtggataaactggccgaagaaggggcggtgctgctgggt
aaaaccaacatggacgagtttgccatgggttcttccaccgaaaactcggccttctttacc
acccgaaacccttggaataccgccaaagttcccggcggctcttccggaggttcggctgcc
tgcgtggctgcttcggaagcggtcttttcactgggttcggataccggcgggtctatccgc
cagccggccagcttctgcagtgttaccggactgaaaccaagctacggcatggtaagccgc
tacgggctggtagcctttgccagttcgcttgaccagataggcccttttaccaaagatgtt
ttggactgtgctctggtaatgaatgctattgccggctttgatgaccgtgactccacctcc
gtcccccaggcagtgccagatttcagcagctgccttgacggggatataaaggggtttaaa
ctgggtgtacccaaagaatatttcagccagaatatgagggcggatatagccgagaagata
aatgacgcgctgagcgtactttcgggtctgggtgcaagcgtagaccacgaggtatctctg
ccccatactccatacgcactggcggtttattacatactggcaccctccgaggcttcggcc
aatttgtcacgatatgacggggtaaaatacggttattcttacaaccagaccgaaaacatg
tgggaagctatggaaaagacccgcgccaaaggattcggacctgaagtaaaacgccgtatt
atgataggcacttatgccctttctgccggctattatgacgcctggtatgtcaaagcccag
aaggtacgcacacttataagtcaggaatttaacaatgcctttgaaaaatatgacgccctg
ataacccctactacccccaacctgcctttcagtgtcggtgaaaagctgaatgaccccttt
gagatgtacatgtgtgatacctgtactatccccataaatattgccggattgcccgccata
agcataccggctggtttcgtagatggtttaccggtgggtttacaaattataggcaagccc
tttgctgaccagactatcatgcgcatagcccatgccttccagtgcgccactgcctggcac
aaggaaacgcccaggttatag

DBGET integrated database retrieval system