KEGG   Dehalococcoides mccartyi CG4: X793_02805Help
Entry
X793_02805        CDS       T03648                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
dmy  Dehalococcoides mccartyi CG4
Pathway
dmy00550  Peptidoglycan biosynthesis
dmy01100  Metabolic pathways
dmy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dmy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    X793_02805
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    X793_02805
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    X793_02805
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dmy01011]
    X793_02805
Enzymes [BR:dmy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     X793_02805
Peptidoglycan biosynthesis and degradation proteins [BR:dmy01011]
 Precursor biosynthesis
  Amino acid ligase
   X793_02805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C GARS_A CPSase_L_D2 ATPgrasp_Ter ATP-grasp_4 ATP-grasp_3 ATP-grasp Response_reg
Motif
Other DBs
NCBI-ProteinID: AII59307
LinkDB All DBs
Position
534421..535437
Genome map
AA seq 338 aa AA seqDB search
MQIGLSYDLKQALNPVSGGPDDALEEYDSPETVEAITNALTQAGHTVYRLGGGKEFLRRV
QEQKLDLVFNIAEGLGNYRSREAQIPGILEMLDIPYTGSDPQTLAVCLDKPLTKKLVADA
GIKTARWQLVTSCEELSAIDWSGFPLPAFLKPACEGSSKGVRFASRAGSAKEIVSMAAEL
LTAYEQPVLIEEFMSGEEITVGVTGNIQPKILGIMRVVPKTKTDYFVYSVEVKRNWRQMV
EYEVPAALPAETLSRIEKATLDAYKVLGCRDLCRMDFRVSPDGIPYFLEVNPLPGLNPVS
GDLPIMASKLGISHAELVLKILDTALARHSLTAANCLP
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcagatagggctgtcatacgatcttaaacaggcgttaaatccggttagcggcggccct
gatgatgcactggaagaatatgactcaccggagacggttgaagctatcaccaatgcttta
acccaggccgggcatacggtttaccgcttgggtgggggaaaagagtttttacgtagggta
caggaacagaaactggacctggttttcaatattgcggagggtttgggtaattaccgcagc
cgtgaggctcaaatccccggtattttagagatgttagatataccgtacaccggctcagat
ccgcagacactggctgtctgtctggataaacccctgactaagaaactggtagctgatgcc
ggtataaaaactgcccggtggcagttagtcaccagctgcgaagagctttcggctatagac
tggtcagggttccccttgccggcttttcttaagcctgcctgtgagggttctagcaagggt
gtcaggtttgcttcacgcgccggaagtgccaaagaaatagtaagcatggcggcagagctg
cttactgcctatgagcagcctgttttgatagaagaatttatgagcggcgaagagattacg
gtaggggttaccggtaatatacagcccaaaattttgggtatcatgcgggttgtccccaag
accaaaactgattattttgtctactctgtagaggtgaaacgcaactggcggcagatggtg
gagtatgaagtaccggcggctttgcctgctgagactttatcccgcattgaaaaggctacg
ctggatgcgtataaggtgctgggctgccgtgacctgtgccgtatggatttcagggtcagc
cctgatggcataccttattttctggaagtaaaccctttgcccggtctaaatcctgtcagc
ggagatttgccgattatggcatctaaactgggtatcagtcatgctgagttggtgttaaaa
atacttgacactgctctggcccgccacagtctgactgcggcaaactgcctgccttag

DBGET integrated database retrieval system