KEGG   Dermacoccus nishinomiyaensis: HX89_01235Help
Entry
HX89_01235        CDS       T03223                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
dni  Dermacoccus nishinomiyaensis
Brite
KEGG Orthology (KO) [BR:dni00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HX89_01235
Enzymes [BR:dni01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HX89_01235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored Glutaredoxin DAO FAD_binding_3 Thioredoxin_4 NAD_binding_9 AlaDh_PNT_C K_oxygenase Lycopene_cycl FMO-like Thi4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AIF39837
UniProt: A0A075JF34
LinkDB All DBs
Position
250295..251845
Genome map
AA seq 516 aa AA seqDB search
MAVLDANMTAQLQQLLGNLREPIVLRASLDDSDKSKQTEELLKEIEALHDKVSYERSDDN
ERRPSFEIARAGTDVGVHFAGLPMGHEFTSLVLALLQVGGHPVKVSDEQAQQIRDIEGTF
YFETYMSLTCQNCPDVVQALNAMSVLNPNIHHIAIEGGAFQDEIEARDIKAVPTVYLNGE
VFGQGRMTVEDFISKLDTGADAKAAAKLSEKEPFGVLVIGGGPAGVAAAIYTARKGIRTG
LVAERIGGQVLDTNAIENFISMPYTEGPKLAAALEAHLHEYEIDVMKAQKVASITDEDGL
KKVVTETGAALRAKQVILATGARWRRMGVPGEEEYRNKGVTFCPHCDGPLFKGKSVAVIG
GGNSGVEAAIDLAGVVGHVTVVEFLDTMRADDVLQRKLKSLPNVDIILSAATSEVVGDGK
GVTGLTYTDRETNESKSIDVEGVFVQIGLLPNTEFLDGVVDLNERKEIVISDRGATSDPA
IFAAGDVTTEPYKQIVVAEGSGATAALGAFDASIRG
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggccgttctcgatgccaacatgacagcccagctgcagcagctgctcggcaaccttcgt
gagccgatcgtgctgcgcgccagcctcgacgactccgacaagtcgaagcagaccgaagag
ctcctcaaggagatcgaggcgctgcacgacaaggtgagctatgagcgcagcgacgacaac
gagcgtcgcccgagcttcgagatcgctcgcgccggcacggacgtcggcgtccacttcgcg
ggcctgccgatggggcatgagttcacgtcgctcgtcctcgcgttgttgcaggtcggcggc
caccccgtcaaggtcagtgacgagcaggcgcagcagatccgtgacatcgagggcacgttc
tacttcgagacatacatgtcgctgacgtgccagaactgccccgacgtcgtgcaggcactc
aacgcgatgagcgtgctcaacccgaacatccaccacatcgcgatcgagggcggcgcgttc
caggacgagatcgaggcgcgcgacatcaaggccgtcccgaccgtctacctcaacggtgag
gtcttcggtcagggccgcatgaccgtcgaagacttcatcagcaagctcgacaccggcgcc
gacgcgaaggccgcggcgaagctcagcgagaaggagccgttcggcgtcctcgtcatcggt
ggtggccccgcgggcgtcgcggccgcgatctacaccgcacgcaagggcatccgcaccggc
ctcgtcgccgagcgcatcggcggccaggtgctcgacacgaacgccatcgagaacttcatc
tcgatgccgtacacggagggccccaagctcgccgccgcgctcgaggcgcacctgcacgag
tacgagatcgacgtgatgaaggcgcagaaggtcgcgtccatcaccgacgaggacggcctc
aagaaggtcgtcaccgagacgggcgccgcactgcgcgccaagcaggtcatcctcgcgacg
ggtgcccgctggcgtcgcatgggcgtcccgggcgaggaggagtaccgcaacaagggcgtc
accttctgcccgcactgcgacggtccgctgttcaagggcaagagcgtcgccgtcatcggt
ggcggcaactcgggcgtcgaggctgcgatcgacctggcgggcgtcgtcgggcacgtcacc
gtcgtcgagttcctcgacacgatgcgcgccgacgacgtgctgcagcgcaagctcaagtcg
ctgcccaacgtcgacatcatcctgtcggccgcgacgagtgaggtcgtcggcgacggcaag
ggcgtcaccggcctgacgtacaccgaccgcgagaccaacgagagcaagagcatcgacgtt
gagggcgtgttcgtccagatcggcctgctgccgaacaccgagttcctcgacggtgtcgtc
gacctcaacgagcgcaaggagatcgtcatctccgaccgcggtgcgacgtccgacccggcc
atcttcgccgccggcgacgtcacgaccgagccgtacaagcagatcgtcgtcgccgaaggc
tccggcgcgacggccgcactcggcgcgttcgacgcgagcatccgcggctga

DBGET integrated database retrieval system