KEGG   Dermacoccus nishinomiyaensis: HX89_02940Help
Entry
HX89_02940        CDS       T03223                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dni  Dermacoccus nishinomiyaensis
Pathway
dni00620  Pyruvate metabolism
dni00680  Methane metabolism
dni01100  Metabolic pathways
dni01120  Microbial metabolism in diverse environments
dni01200  Carbon metabolism
Module
dni_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dni00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HX89_02940
  Energy metabolism
   00680 Methane metabolism
    HX89_02940
Enzymes [BR:dni01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     HX89_02940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase DUF2951
Motif
Other DBs
NCBI-ProteinID: AIF40085
UniProt: A0A075JEI0
LinkDB All DBs
Position
620166..623063
Genome map
AA seq 965 aa AA seqDB search
MSELLHFTTTDADRSATEPLRDDIRLLGGLLGDVIREHEGERVFGLVEDARVKAFGVRRQ
EVDRASFGGTLTGLSTRDALHVIRAFSHFALLANIAEDLHRERRRAAHVAAGEDPQDGSL
AATFRKLAGAHIDGDTAAERLAGATVVPVITAHPTETRRRTVFEAQSHIKRLMRERTRMQ
LDPSEDAENMRQIKLWVLTLWQTALIRLSKITITDEIDAGLRWYDAAFFEVMPTLNAELR
DAFAALLPGAGIADEPVLQAGSWIGGDRDGNPNVTGDVVAYATRRAAETALDHYLDELDK
LQTSLSLSRRMAPVTDELLTLAQHAADAGDARDDEPYRQALSYVHDRLMETHGVVVGADA
GDPGAAGAAGPAGAVGAGQGGEADDPYVAYATPEEFLADLDVIDASLRSTSDDLIADDRL
ATLREAVRTFGFHLYGLDLRQNSETHEATIAELFAWAGVCDDYAALDEDARVELLTAELA
NNRPLAGPNATFSETTTKELAITAAAAHAVRTFGEKAVPNHVISMCTSVSDMLETAVLLK
EAGLLTVTPEGPRCSVNIVPLFETIEDLQVSATTLRAALAVPAYRALVDSKAPPADTHCA
QMHPGSPARKGGGLQEVMLGYSDSNKDGGYMAANWALYRAELDLVEVAEEAGIRLRLFHG
RGGTVGRGGGPSYDAILAQPPGAVRGSLRLTEQGEIIAAKYAEPKLATRNLEALVSATIE
SSLLDVEGLEPSEVEDAYAAMDEIAALAREAYGDLVHRTDGFVDYFKTSTPVAEIGELNI
GSRPSSRKPTSSIADLRAIPWVMSWSLCRVMLPGWYGTGTALERWIGDDDARLAQLRGYV
ERWPFFRSVISNMAQVMAKSDLGLAAEYAELVEDADLRARVFDKIRDEHARTLAMYEKIT
GHDDLLWDNAALKRSVFNRFPYLEPLNHLQVELLRRYRAGDDDPQLKRGILLTMNGLATA
LRNSG
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacttctgcacttcacgaccactgacgcggaccgctcggccaccgagccgctg
cgcgacgacatccgtctgctcggcgggttgctcggtgacgtcatccgcgagcacgagggt
gaacgcgtcttcggcctcgtcgaggacgcccgggtcaaggcgttcggggtccgtcgtcag
gaggtcgaccgcgcgtcgttcggcggcacgctgacggggctgtcgacgcgcgacgccctc
cacgtcatccgagcgttcagccacttcgcgttgctcgcgaacatcgcggaggatctgcac
cgtgagcgtcgccgcgccgctcacgtcgcggcgggggaggacccgcaggacggctcgctc
gcggcgaccttccgcaagctcgccggcgcccacatcgacggggacacggccgccgagcgg
ctggcgggcgccaccgtcgttcccgtcatcacggcacacccgacggagacgcgccgccgc
accgtcttcgaggcgcagagccacatcaagcgcctcatgcgggagcgcacgcgcatgcag
ctcgacccgagcgaggacgcggagaacatgcgccagatcaagctgtgggtgctgacgctg
tggcagacggcactcatccggctgagcaagatcacgatcaccgacgagatcgacgcgggc
ctgcgctggtacgacgccgcgttcttcgaggtgatgccgacgctcaacgccgagttgcgt
gacgcgttcgcggccctgctcccgggcgctggaatcgcggatgagcctgtgctgcaggct
ggttcgtggatcggtggcgaccgtgacggcaaccccaacgtcacgggtgacgtcgtcgcc
tacgccacacgccgtgccgcggagacggcgctcgatcactacctcgacgagctcgacaag
ctgcagacgagcctgtcgctctcccgacgcatggcgcccgtcacggacgagttgctgacc
ctcgcgcagcacgcagctgacgccggcgacgcccgcgacgacgagccctaccgtcaggcg
ttgtcgtacgtgcacgaccgactcatggagacgcatggggtcgtcgtgggggctgatgcg
ggcgatcccggcgcggcgggcgcggctgggccggccggcgccgtcggcgcggggcagggc
ggtgaggctgacgacccgtacgtcgcctatgcgacgcccgaggagttcctcgccgacctc
gacgtcatcgacgcctcgctgcgcagcaccagtgacgacctgatcgccgacgaccgactc
gccacgctgcgagaagcggtgcgcacgttcggttttcacctctacggcctcgacctgcgc
cagaactccgagacgcacgaggcgaccatcgcggagctgttcgcctgggccggcgtctgc
gacgactacgccgcgctcgacgaggacgcccgcgtcgagctgctcaccgcggagctcgcg
aacaaccgtcccctcgccgggccgaatgcgacgttcagcgagacgacgacgaaggaactc
gcgatcaccgcggccgccgcacacgccgtcaggacgttcggtgagaaggccgtgccgaac
cacgtcatctcgatgtgcacgagcgtgtccgacatgctcgagacggccgtcctgctcaag
gaggccgggctgctgacggtgacgccagagggtccgcgctgcagcgtcaacatcgtgccg
ctgttcgagacgatcgaggatctgcaggtctccgcgacgacgctgcgcgcggcgctcgcc
gtccccgcctaccgcgccctcgtcgattcgaaggcgccgcccgccgacacccactgcgcg
cagatgcacccgggttcacctgcacgcaagggcggagggctgcaggaggtcatgctcggc
tacagcgactcgaacaaggacggcggctacatggccgccaactgggcgctgtaccgcgcc
gaactcgacctcgtcgaggtggccgaagaagccggcatccgactgcggctgttccacggc
cgaggcggcaccgtcggacgtggtggtggcccgagctacgacgcgatcctcgcgcaaccg
ccgggcgccgtgcgcggctcgctgcgcctcaccgaacagggcgagatcatcgccgccaag
tacgccgaaccgaagctcgccacgcgcaacctcgaggcactcgtctccgcgacgatcgag
tcgtccctgctcgacgtcgagggtctcgaaccatccgaggtcgaagacgcctacgccgcg
atggacgagatcgccgccctcgcccgcgaggcgtacggcgacctcgtgcaccgcaccgac
ggattcgtcgactacttcaagacgtcgacgcccgtcgccgagatcggcgaactcaacatc
ggctcccgccccagctcacgcaaaccgacgtcgtcgatcgccgacctgcgcgccatcccg
tgggtgatgtcgtggtcgctgtgccgcgtcatgctgcccggctggtacggcacgggcacc
gccctcgaacgctggatcggtgacgacgacgcgcgcctcgcgcagctgcgcggctatgtc
gaacgctggccgttcttccgctccgtcatctccaacatggcgcaggtcatggcgaaatcc
gaccttggactcgccgccgaatacgccgaactcgtcgaagacgccgacctgcgagcgcgc
gtgttcgacaagatccgcgacgaacacgcccgcaccctcgccatgtacgagaagatcacc
ggccacgacgacctgctgtgggacaacgccgctctcaaacgttccgtcttcaaccgcttc
ccctacctcgagcccctcaaccacctgcaggtcgaactcctgcgccgctaccgcgccggc
gacgatgacccccaactcaaacgcggcatcctgctcacgatgaacggactggcgacagcg
ctgcgcaactcggggtga

DBGET integrated database retrieval system