KEGG   Dermacoccus nishinomiyaensis: HX89_04665Help
Entry
HX89_04665        CDS       T03223                                 

Definition
(GenBank) superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
dni  Dermacoccus nishinomiyaensis
Brite
KEGG Orthology (KO) [BR:dni00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HX89_04665
Enzymes [BR:dni01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     HX89_04665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni
Motif
Other DBs
NCBI-ProteinID: AIF40358
UniProt: A0A075JJW8
LinkDB All DBs
Position
complement(976607..977011)
Genome map
AA seq 134 aa AA seqDB search
MLKRFFTPTVEVSAHCDLPCGVYDPAQARIEAESVKAIIAKVADKPGDEDFKMRATIIKE
QRSQLVKEHLWVLWTDYFKPPHFEKYPQLHTLVNEATKLAGASGTKGEWDIAKADELLGK
IDEIARIFAETKQA
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagcgtttcttcacccccaccgtcgaggtctcggctcactgcgacctgccctgc
ggcgtctacgaccctgcccaggcccgcatcgaggccgagtcggtcaaggccatcatcgcc
aaggtcgccgacaagcccggcgacgaagacttcaagatgcgcgccacgatcatcaaggag
cagcgcagccagctcgtcaaggagcacctgtgggtgctgtggacggactacttcaagccc
ccgcacttcgagaagtacccgcagcttcacaccctcgtcaacgaggcgacgaagctcgcc
ggtgccagcggcaccaagggcgagtgggacatcgccaaggctgacgagttgctcggcaag
atcgacgagatcgctcgtatcttcgcggagacgaagcaggcctga

DBGET integrated database retrieval system