KEGG   Dermacoccus nishinomiyaensis: HX89_04850Help
Entry
HX89_04850        CDS       T03223                                 

Definition
(GenBank) ATP F0F1 synthase subunit beta
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Organism
dni  Dermacoccus nishinomiyaensis
Pathway
dni00190  Oxidative phosphorylation
dni01100  Metabolic pathways
Module
dni_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:dni00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    HX89_04850
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:dni00194]
    HX89_04850
Enzymes [BR:dni01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     HX89_04850
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     HX89_04850
Photosynthesis proteins [BR:dni00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   HX89_04850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N AAA AAA_19 RsgA_GTPase AAA_25 ATPase T3SS_ATPase_C ATPase_2 Dynactin_p22 ABC_tran NACHT LRV_FeS AAA_16 NB-ARC
Motif
Other DBs
NCBI-ProteinID: AIF40386
UniProt: A0A075JDK6
LinkDB All DBs
Position
1015396..1016856
Genome map
AA seq 486 aa AA seqDB search
MTATINESATAAPAAGGVGRVSRVIGPVVDVEFSADTMPEVYNLLTLEVSLNGEKKNINL
EVAQHIGDSMVRAISLQPTDGIVRGSEVRDSGGPISVPVGDVTLGHVFNATGDCLDLEEG
EKLEVNERWGIHRTAPAFDQLESKTTMFETGIKVIDLLTPYVQGGKIGLFGGAGVGKTVL
IQEMIARVARNHGGVSVFAGVGERTREGNDLMVEMEEAGVLGQTALVFGQMDEPPGTRLR
VALSALTMAEYFRDVQKQDVLLFIDNIFRFTQAGSEVSTLLGRMPSAVGYQPTLADEMGV
LQERITSTRGHSITSMQAIYVPADDYTDPAPATTFAHLDATTELSRDIASMGIYPAVDPL
TSTSRILDPRYISKEHYETAVRIKSILQRNKELQDIIAILGIDELSEEDKILVNRARRIQ
RFLSQNTYVAKQFTGIEGSTVSLQDSIEAFTKIADGDYDHVPEQAFFMCGGLDDVERQAA
ELAKQD
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgactgccaccatcaacgaaagcgcaaccgcggccccggccgcgggcggcgtgggccgc
gtctcgcgcgtcatcggcccggtcgtcgacgtcgagttctcggccgacacgatgccggag
gtctacaaccttctgacgctcgaggtctcgctcaacggcgagaagaagaacatcaacctc
gaggtcgcccagcacatcggtgactcgatggttcgcgccatctcgctgcagccgacggac
ggcatcgtccgcggctccgaggtgcgcgactccggcgggccgatctccgtgccggtcggc
gacgtcaccctcggtcacgtcttcaacgcgacgggtgactgcctcgacctcgaggagggc
gagaagctcgaggtcaacgagcgctggggcatccaccgcacggcgcccgcgttcgaccag
ctcgagtccaagacgacgatgttcgagacgggcatcaaggtcatcgacctgctgaccccg
tacgtccagggcggaaagatcggtctgttcggtggtgccggtgtcggcaagaccgttctg
atccaggagatgatcgctcgagtcgctcgcaaccacggtggtgtgtccgtgttcgccggt
gtcggtgagcgcacccgtgagggcaacgacctcatggtcgagatggaagaggccggcgtc
ctcggccagaccgcgctcgtgttcggccagatggacgagccgccgggaacgcgtcttcgc
gtcgccctgtcggcgctgacgatggcggagtacttccgcgacgtgcagaagcaggacgtg
ttgctgttcatcgacaacatcttccgcttcacgcaggccggttccgaggtctccacgctg
ctcggccgcatgccgtccgccgtgggttaccagccgacgctggctgacgagatgggtgtg
ctccaggagcgcatcacctcgacgcgtggtcactcgatcacgtcgatgcaggccatctac
gtgccggccgacgactacaccgacccggccccggcgacgacgttcgcgcacctcgatgcg
acgaccgagctctcgcgtgacatcgcgtcgatgggtatctacccggccgtggacccgctg
acgtcgacgtcgcgcatcctcgacccgcgttacatctcgaaggagcactacgagacggcg
gttcgcatcaagtcgatcctgcagcgcaacaaggaactgcaggacatcatcgcgatcctc
ggtatcgacgagctctccgaagaggacaagatcctcgtcaaccgcgctcgccgtatccag
cgcttcctgtcgcagaacacctacgtcgccaagcagttcaccggcatcgagggttcgacg
gtgtcgctgcaggactcgatcgaggccttcacgaagatcgcggacggcgactacgaccac
gtccccgagcaggccttcttcatgtgtggtggcctcgacgacgtcgagcgtcaggccgcg
gagctggccaagcaggactga

DBGET integrated database retrieval system