KEGG   Dermacoccus nishinomiyaensis: HX89_07080Help
Entry
HX89_07080        CDS       T03223                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
dni  Dermacoccus nishinomiyaensis
Pathway
dni00220  Arginine biosynthesis
dni00250  Alanine, aspartate and glutamate metabolism
dni00290  Valine, leucine and isoleucine biosynthesis
dni01100  Metabolic pathways
dni01110  Biosynthesis of secondary metabolites
dni01130  Biosynthesis of antibiotics
dni01210  2-Oxocarboxylic acid metabolism
dni01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dni00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HX89_07080
   00290 Valine, leucine and isoleucine biosynthesis
    HX89_07080
   00220 Arginine biosynthesis
    HX89_07080
Enzymes [BR:dni01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     HX89_07080
    2.6.1.66  valine---pyruvate transaminase
     HX89_07080
Amino acid related enzymes [BR:dni01007]
 Aminotransferase (transaminase)
  Class I
   HX89_07080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Aminotran_MocR Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AIF40740
UniProt: A0A075JG17
LinkDB All DBs
Position
complement(1509882..1511135)
Genome map
AA seq 417 aa AA seqDB search
MRAIRQSNKLQNVRYDVRGPILEEAQRLEAEGHKILKLNIGNTAPFGFEAPEAILADMKH
HLHHAQGYSDSRGIYSARTAVAQYYQSRGLKDTQVEDVYIGNGVSELITMVLQAFVDDGN
EILVPAPDYPLWTGAVSLTGGTPVHYLCDEENGWNPDLADIESKITENTHAIVIINPNNP
TGAVYSEDVVRGLVDIARRHDLVVMADEIYEKILFEDAVHHHAATFAGDDVLCLTFSGLS
KAYRVCGYRAGWVMISGPKHLAEDFLEGLTLLANMRMCANVPAQHAIQTALGGYQSISEL
IGPDGRFYEQSMLAWRMLNEIPGVSCVKPMGSLYTFPRLDPEIYPIDNDQDFVIDLLRAK
KILVTHGTGFNWVAPDHFRLVTLPDVDVLEEAIGRIADFLEDYRHRAGTGDLVPERA
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcgatccgacagtcgaacaagctccagaacgtccgctacgacgtgcgtggcccg
atcctggaggaggcgcagcggctcgaggccgagggtcacaagatcctgaagctcaacatc
ggcaacacggcgccgttcggattcgaggcgccggaggcgatcctcgcggacatgaagcac
cacctgcaccacgcgcagggctacagcgacagccgcggcatctattcggcgcgcacggcc
gtcgcgcagtactaccagagccgcggcctcaaggacacgcaggtcgaggacgtctacatc
ggcaacggcgtctccgagctcatcacgatggtgctgcaggcgttcgtcgacgacggcaac
gagatcctcgtgcccgcccccgactatccgctgtggaccggtgcggtctccctcaccggc
ggtacgcccgtgcactacctgtgcgacgaggagaacggctggaacccggatctggcggac
atcgagtcgaagatcaccgagaacacccacgccatcgtcatcatcaatccgaacaacccc
acgggcgccgtctactccgaggatgtcgtgcgcggcctcgtcgacatcgcgcgccgccac
gacctcgtcgtcatggccgatgagatctacgagaagatcctgttcgaggacgctgtgcat
caccacgccgcgacgttcgcgggcgacgacgtcctgtgcctcaccttcagcggcctgtcc
aaggcctaccgcgtgtgcggttaccgcgccggttgggtcatgatctccgggccgaagcac
ctcgccgaggacttcctcgagggtctgacgctgctcgccaacatgcgcatgtgcgccaac
gtgcccgcgcagcacgccatccagaccgcgctcggcggctaccagtcgatcagcgagctc
atcggacctgacggccgcttctacgaacagtcgatgctggcctggcgaatgctcaacgag
atccccggcgtcagctgcgtcaagccgatgggctcgctctacaccttcccgcgcctcgac
cccgagatctacccgatcgacaacgaccaggacttcgtcatcgacctcctgcgggccaag
aagatcctcgtcacgcacggcacgggcttcaactgggtcgcccccgaccacttccgactc
gtcacgctgcccgacgtcgacgtgctcgaagaggccatcggacgtatcgctgacttcctc
gaggactaccgccaccgcgccggcaccggcgacctcgtgcccgaacgcgcctga

DBGET integrated database retrieval system