KEGG   Dermacoccus nishinomiyaensis: HX89_10740Help
Entry
HX89_10740        CDS       T03223                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
dni  Dermacoccus nishinomiyaensis
Pathway
dni00020  Citrate cycle (TCA cycle)
dni00480  Glutathione metabolism
dni01100  Metabolic pathways
dni01110  Biosynthesis of secondary metabolites
dni01120  Microbial metabolism in diverse environments
dni01130  Biosynthesis of antibiotics
dni01200  Carbon metabolism
dni01210  2-Oxocarboxylic acid metabolism
dni01230  Biosynthesis of amino acids
Module
dni_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dni_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:dni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HX89_10740
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    HX89_10740
Enzymes [BR:dni01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     HX89_10740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIF41336
UniProt: A0A075JGK3
LinkDB All DBs
Position
complement(2306563..2307783)
Genome map
AA seq 406 aa AA seqDB search
MEKIKVKNPIVELDGDEMTRIIWQFIKDRLIHPYLDVDLKYYDLGIENRDATDDQVTVDA
ANAIKQYGVGVKCATITPDEARVEEFGLKEMWKSPNGTIRNILGGVIFREPIIISNVPRL
VPGWTKPIIVGRHAHADQYKAQNFKVPGAGTVEISYTPADGGEKQVYEVAEFPESGGVAM
GMYNYNKSIEDFARASFNYGLERNMPVYLSTKNTILKAYDGAFKDIFQDVFDREFKAEFD
KRGLTYEHRLIDDMVASALKWEGGYVWACKNYDGDVQSDIVAQGFGSLGLMTSVLMTPDG
KTVEAEAAHGTVTRHYRQHQQGKETSTNPIASIFAWTRGIAKRGELDGTPEVTKFAETLE
RVCVQTVEEGKMTKDLALLISKDQPYLNTQDFLAAIDENLSKAMAA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggagaagatcaaggtcaagaaccccatcgtcgagctcgacggtgacgagatgacgcgc
atcatctggcaattcatcaaggaccgcctgatccacccgtacctcgacgtcgacctcaag
tactacgacctcggcatcgagaaccgtgacgcgacggacgaccaggtcaccgtcgacgcg
gcgaacgcgatcaagcagtacggcgtcggcgtcaagtgcgcgacgatcacgccggacgag
gcgcgcgtcgaggagttcggcctcaaggagatgtggaagagccccaacggcaccatccgc
aacatcctcggtggcgtgatcttccgcgagccgatcatcatcagcaacgtgccgcgcctc
gtgccgggctggacgaagccgatcatcgtcggccgtcacgctcacgccgaccagtacaag
gcgcagaacttcaaggtgcccggtgccggcaccgtcgagatctcctacaccccggccgac
ggtggcgagaagcaggtctacgaggtcgccgagttccccgagtccggcggcgtcgcgatg
ggcatgtacaactacaacaagtcgatcgaggacttcgctcgcgcgtcgttcaactacggc
ctcgagcgcaacatgcccgtctacctgtccacgaagaacaccatcctcaaggcgtacgac
ggcgcgttcaaggacatcttccaggacgtcttcgaccgcgagttcaaggccgagttcgac
aagcgcggcctcacgtacgagcaccgcctcatcgacgacatggtcgcctctgcgctcaag
tgggagggcggctacgtctgggcgtgcaagaactacgacggtgatgtgcagtccgacatc
gtcgcgcagggcttcggctcgctcggcctcatgacgtccgtgctcatgacgcccgacggc
aagacggtcgaggcggaggccgcgcacggcaccgtcacgcgtcactaccgtcagcaccag
cagggcaaggagacgtcgacgaacccgatcgcgtcgatcttcgcctggacgcgcggcatc
gccaagcgtggcgagctcgacggcacacccgaggtgacgaagttcgccgagaccctcgag
cgcgtctgcgtgcagacggtcgaggagggcaagatgacgaaggacctcgcgctgctcatc
agcaaggaccagccgtacctcaacacgcaggacttcctcgccgccatcgacgagaacctc
agcaaggccatggctgcctga

DBGET integrated database retrieval system