KEGG   Dichelobacter nodosus: DNO_0144Help
Entry
DNO_0144          CDS       T00517                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
dno  Dichelobacter nodosus
Brite
KEGG Orthology (KO) [BR:dno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DNO_0144
Enzymes [BR:dno01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DNO_0144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 HI0933_like GIDA FAD_oxidored DAO NAD_binding_8 AlaDh_PNT_C Thi4 NAD_binding_7 FAD_binding_2 Lycopene_cycl FAD_binding_3 K_oxygenase Glutaredoxin DSBA Str_synth FMO-like 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ABQ13898
UniProt: A5EWM4
LinkDB All DBs
Position
150253..151812
Genome map
AA seq 519 aa AA seqDB search
MIDQSLLDAVKQYAQSLSKDVTFVMQTGTHSKRDELKTFLEEISSVSEKIHVIERDFSGA
RNAISFTLEVDNQATGIYFSGIPGGHEFSSLILALLQAGGAALKLDNSIQNFIRTIDEPL
HFETFVSLSCHNCPEVVQALNQFVLLNPLIHSEMIDGGLFQEEIEKRNIQGVPAVFLNGQ
SFINGKIDTAKIIEKLLEKYPHFAQKMAAEEQLPLQDVTVIGGGPAGSAAAIYAARKGLK
VTLIADRIGGQVKDTVSIENLIGTKETTGSKLALQLQEHIQANAIIVKENISVKSVETHE
GSHVVILQTGERIQTKTLIVASGAKWRELGVPGEKENLGKGVAYCPHCDGPFFKGKHVAV
IGGGNSGIEAAIDLSGIVRKVSVFEFADTLKADKVLVDSAQSRDNIEIFTGVMTQSIAAE
NGKVTAIHYQERASGAEKTLALDGVFVQIGLIPNTAFLGDAVKRTRFGEIEINGRCETST
AGIFAAGDCTNVPYKQIIIAMGEGAKAALSAFDYLIRQK
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgattgatcaatctttactagatgcagtgaaacaatacgcccaatcattgagcaaagac
gtcacttttgtgatgcaaacgggcacccattctaaacgcgatgaattgaaaacattcctt
gaagaaatcagcagcgtttctgaaaaaatacacgttattgaacgtgatttttcgggtgcg
cgaaacgccatttctttcactttagaagtggataatcaggcaaccggcatttatttttcg
ggcattcccggcggacacgaattttcatcgctcattttggcgttgttgcaagccggtggc
gctgctttaaaactcgataacagcattcaaaattttatccgcacgattgatgagccttta
cattttgaaacgtttgtttcgttatcgtgccataactgtccggaagttgtgcaagcatta
aatcaatttgtattgctcaacccattgattcatagcgaaatgattgacggcggtttattc
caagaagaaatcgaaaaacgcaatattcaaggtgtgccggcagtatttttaaacggtcaa
tcctttattaacggcaaaatcgatacggcaaaaattattgaaaaacttttggaaaaatac
ccacattttgcgcaaaaaatggcggcagaagaacaattaccgctgcaagatgtaaccgtt
attggcggtggacctgccggatcggcggcggcaatttatgcggcgcgcaaagggttaaaa
gttacgttgattgccgatcgcatcggtggacaagtgaaagatacggtgagtattgaaaat
ttaatcggcactaaagaaaccactggctccaaattagcgctgcaattacaagaacatatt
caagccaacgctatcatcgttaaagaaaatatttccgttaaaagcgttgaaacgcacgaa
ggctcccatgtggtgattttgcaaacgggcgaacgtattcaaacgaaaacgctcattgtt
gccagcggcgcaaaatggcgggaattaggcgttccaggggaaaaagaaaatttaggcaaa
ggcgttgcttattgtccgcattgcgatggaccttttttcaaaggtaaacacgtagccgtt
attggtggcggtaattctggcattgaagcggcaattgatttgtccggaattgtgcgaaaa
gtgagcgtttttgaatttgccgatacgttaaaagcggataaagttttagtcgattcggcg
caatctcgcgataacattgaaatttttaccggcgtaatgacgcaatctatcgctgcggaa
aacggcaaagtcaccgcgattcattatcaagaacgcgccagcggtgcagaaaaaactttg
gcattagacggcgtatttgtgcaaattgggttgattccgaacacggcttttttaggcgat
gcggtgaaacgtacgcgttttggtgaaattgaaattaacgggcgttgcgagacttcaacg
gcgggcatttttgccgcgggcgattgtacgaatgtcccgtataaacaaattattattgcg
atgggagagggcgcaaaagcggcactttctgcgtttgattatttgattcgtcaaaaataa

DBGET integrated database retrieval system