KEGG   Dichelobacter nodosus: DNO_0212Help
Entry
DNO_0212          CDS       T00517                                 

Definition
(GenBank) FAD dependent oxidoreductase family protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dno  Dichelobacter nodosus
Pathway
dno00564  Glycerophospholipid metabolism
dno01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DNO_0212
Enzymes [BR:dno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DNO_0212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 HI0933_like GIDA Pyr_redox_2 Pyr_redox_3 NAD_binding_8 Lycopene_cycl Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: ABQ13165
UniProt: A5EWH0
LinkDB All DBs
Position
227716..229275
Genome map
AA seq 519 aa AA seqDB search
MNRVNALCQLSQAKCWDVVVIGGGATGLGIALDAITRGFSTLLLEAKDFAQGTSSRSTKL
VHGGVRYLAQGDVALVREALRERGRLAKNAPHLFKIQPFIIPGEYFWTAPYYTFGLWLYD
RLSGKLSIGATRYLSKTETQKRLAGIKAEKIRAGVCYYDGQFDDARLAVTLAQSAVDHGA
TVLNYCPVVALHKNDAGKVDGVVAQDAFSQQSYQISARAVINATGVFANEIVAMDEPDSK
PRIVPSQGIHLVFDRDLLASDDALMVPKTSDGRVLFAVPWHDKLVVGTTDTLVNSVSYDP
KPLDQEIQFILETARDYFKRAPTRADVKSVFVGLRPLAAPKKEGKATKEVSRSHKVHISD
SGLVHIIGGKWTTYRQMAEDTIDAAMKANLLPKKACQTVALKLHGYQESSLSDSFLSVYG
SDTAALQKYSADDAALAEKIHPDYPYLLAQVAWAIDHESALTLEDILARRIRLLFLDARA
AAQSAEKVARFMAKRLQWDDERLQTELNNFTAKAAQYHL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgaacagagtaaacgcgctttgtcagttatcacaggcaaagtgttgggacgttgtcgtc
atcggcggcggcgcaacgggattaggcattgcactcgatgcgattacccgcggtttttct
actttattgctcgaagctaaagattttgctcaaggaacgtccagtcgttccacaaaattg
gtacacggcggcgtgcgttatttagcacaaggcgatgttgctttggtgcgcgaagcgtta
agagaacgcggacgtttggcaaaaaatgccccgcatttatttaaaattcaaccgtttatt
attcctggtgaatatttttggacagcaccttattacacttttggtttgtggttatacgat
cggctttccggaaaattaagcatcggcgcaacccgttatttatctaaaacggaaacgcaa
aaacgactcgccggcattaaagcagaaaaaatccgcgccggtgtatgttattacgacggg
caatttgatgacgcgcgtttagcagtaacgttggcgcaatctgccgttgaccacggcgcg
accgtgctcaattattgccctgttgtggcattacataaaaacgacgcgggtaaagttgat
ggcgtggtggcgcaagatgcgttttctcaacagtcttaccagatttcagcgcgcgcggtg
attaatgccacgggcgtttttgccaatgaaattgtggcgatggacgagcccgacagtaaa
ccgcgcattgtgcccagtcagggaattcatttggtttttgaccgcgatttattagccagc
gatgatgcgttaatggtgccgaaaaccagcgatggacgcgttctttttgcggtgccgtgg
catgataaattggtggtgggaacaaccgatacgctcgttaattcagttagttatgatcct
aaaccattggatcaagaaattcagtttattttagaaaccgctcgagattattttaaacgc
gcgccaacgcgggcagatgtaaaaagcgtttttgtgggattgcgtccgctggcagcgccg
aaaaaagaaggcaaagcaacgaaggaagtttcgcgcagtcataaagttcatatcagcgat
tcgggattggtgcatattatcggcggcaaatggacgacgtatcgccaaatggcagaagat
acgattgacgccgcaatgaaagccaatttattgccgaaaaaagcctgccaaacagtggcg
ctcaaattgcacggttatcaagaatcttcattaagcgattcttttttaagcgtttacggc
agcgatactgcagcattacaaaaatacagcgccgatgatgcggctttagcagaaaaaatt
caccctgattatccttatcttttggcgcaagttgcttgggcaattgatcacgaaagcgcg
ttgactttggaggatattttagccagacgtattcgtttattatttttagatgcccgcgct
gccgcacaatcggcggaaaaagtggcgcggtttatggcaaaacgtttgcaatgggacgat
gaacgtttgcaaacagaattgaacaattttactgccaaagcagcgcagtatcatttgtaa

DBGET integrated database retrieval system