KEGG   Dichelobacter nodosus: DNO_0979Help
Entry
DNO_0979          CDS       T00517                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
dno  Dichelobacter nodosus
Pathway
dno00473  D-Alanine metabolism
dno00550  Peptidoglycan biosynthesis
dno01100  Metabolic pathways
dno01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DNO_0979
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DNO_0979
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    DNO_0979
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dno01011]
    DNO_0979
Enzymes [BR:dno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DNO_0979
Peptidoglycan biosynthesis and degradation proteins [BR:dno01011]
 Precursor biosynthesis
  Amino acid ligase
   DNO_0979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATPgrasp_ST ATP-grasp_3 ATP-grasp_4 RimK TTL CPSase_L_D2 ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: ABQ13693
UniProt: A5EY21
LinkDB All DBs
Position
complement(1019790..1020722)
Genome map
AA seq 310 aa AA seqDB search
MIQAIELGKVAVLYGGNSSEREISLIGGRAVHAALCAAGIDAHLLDTGDPNRIWTLKDEH
FSRAFVMLHGRGGEDGEIQAILQWLGIPYTGSRVLACALAMDKVVCKKVWQSAGLPVLAD
VLVTPESRFETLVEQLHCQDFVIKPALEGSSVGVSRVKNQEQLAAAIPFAGGARAKIMAE
PWIVGRELTYGIVNDTVLPAIEIVAGNDHDFYDYDAKYHAANTQYLCPAPIDAALDARCR
EIAFAAFQAIGARGWGRVDMIVDAQNRPYLLEINLVPGMTTHSLVPMAAQQIGMDFSALV
QSILAQTLTS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgattcaagcaatagaattgggtaaagttgccgtgttatatggaggtaattcctccgaa
cgagaaatttcgttgatcggcgggcgcgcggtgcatgcggcgttatgcgctgctggaatt
gatgcgcatttattggatacgggcgaccccaatcgtatttggacgttgaaagacgagcat
ttctcgcgcgcgtttgtgatgttacacggtcgcggcggcgaagatggcgaaattcaagcg
attttgcaatggttggggattccatataccggaagccgcgttttagcgtgcgctttggcg
atggataaagtggtttgtaaaaaagtatggcagagtgcgggattgcccgtgctggctgat
gttttggtgacgccggaaagtcgttttgaaacgcttgtagaacaattgcactgtcaggat
tttgtgattaaaccagcattagaaggctcgagcgtgggcgtcagtcgcgttaaaaatcag
gaacaattagcggcggcgattccttttgccggcggtgcgcgtgcaaaaattatggcagaa
ccttggattgtaggacgcgaactgacgtatggcattgttaatgatacggttttaccagca
attgaaatcgttgccggcaatgatcatgatttttatgattacgacgcgaaatatcacgcg
gcaaatacgcaatatttgtgccccgcgccgattgatgctgctttagatgcgcgttgtcgc
gaaattgcttttgcggcatttcaagcgatcggtgcgcgcggctggggacgagttgatatg
attgttgatgctcaaaatcgaccgtatttgttggaaattaatttggtgccgggtatgacg
acgcattctttagtgcccatggcagcgcagcaaattggtatggatttttcggcactggtg
caatcgattttggcacaaacgttaacttcttaa

DBGET integrated database retrieval system