KEGG   Drosophila navojoa: 108650818Help
Entry
108650818         CDS       T05898                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
dnv  Drosophila navojoa
Pathway
dnv00040  Pentose and glucuronate interconversions
dnv00051  Fructose and mannose metabolism
dnv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    108650818
   00051 Fructose and mannose metabolism
    108650818
Enzymes [BR:dnv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     108650818
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Pyr_redox_2 NCD3G Methyltransf_16 Phosphonate-bd Glyco_tran_WecB
Motif
Other DBs
NCBI-GeneID: 108650818
NCBI-ProteinID: XP_017955602
LinkDB All DBs
Position
Unknown
AA seq 359 aa AA seqDB search
MAQDNLTAVLHGINDLRLEQRPIPEISDEEVLIAMDSVGICGSDVHYLTKGRIGHFVVTK
PMVIGHESAGVVAKVGSKVKNLAVGDRVAIEPGVPCYKCDHCKQGSYNLCPDMAFCATPP
YDGNLTRYYKHAADFCFKLPDHVTMEEAALLEPLSVGVHACRRAGVGLGSKVLILGAGPI
GLVTLLVAQSLGATEILITDLVQQRLDVAKELGATHTLLLNKEDVAEDIAERVRQLMSAE
PDKAIDCCGAESSTRLAIFATRSGGVVVIVGMGPPEMKLPLFNALAREVDIRGVFRYCND
YSAALALVASGRVNVKRLVTHHFDITETQKAFETARDGLGGAIKVMIHVQARNTNNPVF
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggataatctgacagcagttctgcacggaataaacgacttgcgattggagcaa
cgtccgatcccggaaatatcagatgaggaggtattaatcgcaatggatagcgtcgggatt
tgtggatcagatgttcattacttaactaaaggccgtatcggccactttgtggtgaccaag
cccatggtaattggtcatgaaagtgcaggcgtggttgccaaagtgggcagcaaagttaag
aatctggctgtaggagatcgagttgctattgaaccgggagttccttgctacaaatgcgat
cattgtaagcaaggcagctacaatttgtgtcctgacatggcattctgtgccacgccccct
tacgatggtaatctgacccgatactataaacacgcagcggacttttgctttaagctacct
gatcatgtcaccatggaggaagctgctttactagaaccgttgtccgtgggcgtacatgct
tgccgtcgtgctggtgtgggcctaggctccaaggtgcttatccttggtgcaggtccaatt
ggactggttacgttactggtagcacaatctttgggagccacggaaattctgatcacggat
ttagtacagcaacgtctggatgttgccaaagagttgggcgccacccatacactgctgcta
aataaagaagatgtcgcggaagacatcgctgagcgtgtgcgtcaattgatgagtgcagaa
cccgataaggcgatcgactgctgcggagcagagagcagcacgcgactggcaatctttgct
acacgatctggcggtgttgttgttattgttggcatgggaccgcctgaaatgaagctaccc
ctgttcaatgccttggctcgagaggtagacattcgcggtgtcttccgttactgcaatgac
tattccgctgccttggctctggtggcgtctggaagagtgaatgtaaagcgccttgtcaca
catcattttgatatcacagagactcaaaaagcattcgaaacagctcgggatgggttaggt
ggcgccattaaagttatgatacatgtacaagctagaaatacaaataatccagtattttag

DBGET integrated database retrieval system