KEGG   Drosophila navojoa: 108652571
Entry
108652571         CDS       T05898                                 

Definition
(RefSeq) cell death protein rpr
  KO
K20014  cell death protein rpr
Organism
dnv  Drosophila navojoa
Pathway
dnv04214  Apoptosis - fly
dnv04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dnv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108652571
   04215 Apoptosis - multiple species
    108652571
SSDB
Motif
Pfam: MtrG DUF3177
Other DBs
NCBI-GeneID: 108652571
NCBI-ProteinID: XP_017958271
LinkDB
Position
Unknown
AA seq 67 aa
MAVAFYIPDQKEMLRKAREQEKQLLRLRQWQMATVVLNTIRQLMDSTASECVQRAGRKCG
KWRKPSQ
NT seq 204 nt   +upstreamnt  +downstreamnt
atggctgtggccttctacataccggatcagaaggaaatgctgcgcaaggcgcgcgaacag
gagaaacagctgttgcgtctacgtcaatggcaaatggcaacagttgtattgaacacgata
cgccagctaatggactccacggccagtgagtgtgtgcagcgagcgggacgcaagtgtggc
aagtggcgcaaaccatcgcaatga

DBGET integrated database retrieval system