KEGG   Drosophila navojoa: 108652601
Entry
108652601         CDS       T05898                                 

Definition
(RefSeq) cell death protein Grim
  KO
K20018  cell death protein Grim
Organism
dnv  Drosophila navojoa
Pathway
dnv04214  Apoptosis - fly
dnv04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dnv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108652601
   04215 Apoptosis - multiple species
    108652601
SSDB
Motif
Pfam: TFIIA DUF2722 MMU163 Presenilin MAM33 eIF-3_zeta Spt20 Hydin_ADK
Other DBs
NCBI-GeneID: 108652601
NCBI-ProteinID: XP_017958312
UniProt: A0A484BFW1
LinkDB
Position
Unknown
AA seq 153 aa
MAIAYFIPDQAQLLARSRQQQASAQQAGGGVGSSPTNTSRQNETRQQQQQQPQRQQQQQQ
QQQQRTGSSQFRANISVPLGREQGAMSMSEFGCWELLAQIFCYALRLYSYNPAQRRPTVI
QISFEISSSGASEADADGEATDGAGDVTDAKRE
NT seq 462 nt   +upstreamnt  +downstreamnt
atggcaatcgcttactttatacccgatcaggcgcaactgttggccagaagcaggcaacag
caggcaagtgcgcaacaagcaggaggcggcgtcggctccagtccaacgaataccagcagg
caaaacgagacccgacaacagcagcaacaacaaccacaaagacagcagcagcaacaacaa
caacaacaacagcgcaccggcagctcacagtttcgcgccaacatttcagtgccactgggc
cgcgaacagggcgccatgtccatgtcggagtttggctgctgggagctgttggcccagatc
ttctgctacgccttgcggctgtacagctacaatccagcacagcgccggccgacagtcata
cagatctcgttcgagattagcagcagcggcgcaagcgaggcggatgcggacggagaagct
accgatggggctggagatgtgacagatgcgaagcgggagtag

DBGET integrated database retrieval system