KEGG   Drosophila navojoa: 108654527
Entry
108654527         CDS       T05898                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein isoform X1
  KO
K20017  Bcl-2 family protein
Organism
dnv  Drosophila navojoa
Pathway
dnv04214  Apoptosis - fly
dnv04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dnv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108654527
   04215 Apoptosis - multiple species
    108654527
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 108654527
NCBI-ProteinID: XP_017961457
LinkDB
Position
Unknown
AA seq 298 aa
MPGTSFPTNNDNFSNGFPMVTTQAERLLQAQNRRKFSFPATLHSAALLEVGQRESTRRRL
SNVSDVVTRKLSYTIGWKAAQIPAQDIITQGRCLCGHYIKRRLRRSGLFNKKLGLQRIRS
ILGNSNTTMGIVRDVFPAVQVLGDELERMHPRIYNGVARQICRNPGGEFHTPDAVSLLLG
AVGRELFRVEITWSKVISLFAIAGGLSVDCVRQGHPEYLPKLMESVSEVIEDELVPWINE
NGGWSGINTHVLPTSNSLNPLEWTTLVIGVVFGLILLFMFLRFIVNTLIPKIYQRFTS
NT seq 897 nt   +upstreamnt  +downstreamnt
atgccaggcacctcgttcccaacgaacaacgacaacttcagcaacggcttccccatggtc
acgacccaagccgagcgactgctgcaggcgcagaatcgccgcaagttcagcttccccgcc
acactccactcggccgccctgctcgaggtgggccagcgggagtccacgcgccgccggctc
agcaacgtcagcgatgtggttacccgcaagctctcctacaccatcggctggaaggccgct
caaatacctgcccaagacattatcacacagggacgctgtttatgtggacactacatcaag
cggcggctgcgtcgctcgggactgttcaacaagaaactggggctgcagcgcattcgcagc
atattgggcaacagcaacacaactatgggcatcgtgagagacgttttcccagcggtgcaa
gtgttgggcgatgagctggagcgcatgcatccgcgcatctataatggcgtcgcccgacag
atttgccgcaatcccggcggcgagttccataccccggatgctgtgagtctactcctgggt
gccgtgggccgggagctgtttcgggtcgagatcacatggagcaaggttatctcattgttt
gctatagccggcggtctgtcggtggattgtgtgcgccagggccatcccgagtatttgcca
aagcttatggagagcgtttccgaagttatcgaggatgagctggtgccttggataaacgaa
aacggcggttggagtggcatcaatacacacgttttaccaacatccaacagcttaaatccc
ttggaatggaccacgctggtaattggagttgtattcggattgattttattatttatgttt
ttgcgctttattgtcaacacactgatacctaaaatatatcaacgatttacgagctaa

DBGET integrated database retrieval system