KEGG   Drosophila navojoa: 108659960Help
Entry
108659960         CDS       T05898                                 

Definition
(RefSeq) protein phosphatase 1 regulatory subunit 7
  KO
K17550  protein phosphatase 1 regulatory subunit 7
Organism
dnv  Drosophila navojoa
Brite
KEGG Orthology (KO) [BR:dnv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dnv01009]
    108659960
Protein phosphatases and associated proteins [BR:dnv01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108659960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 LRR_9 LRR_8 Phage_rep_org_N
Motif
Other DBs
NCBI-GeneID: 108659960
NCBI-ProteinID: XP_017968644
UniProt: A0A484BSY9
LinkDB All DBs
Position
2
AA seq 330 aa AA seqDB search
MSMADGDNAVPISGEEKPTAGMQIIPGELVASIEEIVMIDPECYELDLNHRRIDKLENFE
PLKQIERLYLRWNLIKKIENLDTLKTLVELELYDNQITKIENLDNLVNLEILDLSFNRLT
KIENLDKLVKLEKLYFVANKLTVIENLGMLTNLTMLELGDNKLKKIENIETLVNLRQLFL
GKNKIAKIENLDTLVNLEILSLQANRIIKIENLEKLTNLKELYISENGIETIENLSENKC
LDTLDLAKNRLKVIANLEALQQLEELWLNDNGIDNWKNLEVLKVNKALQTIYLEHNPVAT
DVRYRSKLRDILPQLQKIDATLCVLPGQHA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgagtatggctgacggcgacaatgcagtcccgattagtggagaagagaagccaacggcc
ggcatgcagatcattccgggagagctagtggcgtcaatcgaggaaatcgtgatgattgat
cccgagtgctatgaattagatctgaatcatcgtcgtatcgataagctggaaaatttcgag
ccgttgaaacagatcgaacgattgtatctacgatggaacctcatcaaaaagatagaaaac
ctggacacgctaaaaaccctggtggagctggaactgtatgataaccagatcacaaaaatt
gagaatctagacaatttggtcaacctggaaatactcgacctcagcttcaatcgtctgacc
aaaatcgagaatttggacaagctggtgaaactagagaagctctactttgtggccaacaaa
ctaactgtcattgagaacttgggtatgttgaccaatctgacaatgttggagctaggcgac
aacaagctgaagaagattgagaatatcgagacactggtgaatctgcgtcagctatttcta
ggcaagaacaaaatcgcaaaaattgaaaatctagatacgctagtcaacctggagatactg
agtctccaggcaaatcgtattatcaagatcgagaacctggagaagctgaccaatctaaag
gagctgtacatatcagagaatggcatcgaaaccattgagaacctgtccgagaacaagtgt
ctggacacacttgatttggccaaaaacagattgaaggttattgccaacctggaggcgttg
cagcagctcgaagagctctggttaaacgacaatgggatcgacaactggaaaaatctcgag
gtactgaaggtcaacaaagccttgcagacgatctatctggaacataaccccgtggccaca
gatgtacgctatcgctccaagctacgcgacatcctgccccagttacagaaaatagatgcc
accctctgcgtgctgccgggacaacatgcgtaa

DBGET integrated database retrieval system