KEGG   Drosophila navojoa: 108660059Help
Entry
108660059         CDS       T05898                                 

Definition
(RefSeq) pyrroline-5-carboxylate reductase 1, mitochondrial
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
dnv  Drosophila navojoa
Pathway
dnv00330  Arginine and proline metabolism
dnv01100  Metabolic pathways
dnv01230  Biosynthesis of amino acids
Module
dnv_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dnv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    108660059
Enzymes [BR:dnv01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     108660059
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 108660059
NCBI-ProteinID: XP_017968809
LinkDB All DBs
Position
Unknown
AA seq 280 aa AA seqDB search
MAKLDERIGFIGGGNMAFAIGSGLIAGGIVKASQVMVSGPHLENLSRWRDLGAVTTDENY
DVMEHTDIIFICVKPHMLAPCAAQLKYKYVPSAKDASKLLVSVLAGTTLNALEEKFAFIE
TSALKIIRTMPNTSMQVGEGCTVYAGNSHCSHQDLEKVHLMLNSLGLAQQVPETMIDAVT
GVTGCGPAFVYTIIEAFADGGVKQGVPRQMALQFAAQTLLGAAKTVLLTGKHPAVLRDEV
CSPGGSTIVGVHELEKGNLRATIINAVEKASLRSAELGKK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagttggatgagcgtattggatttattggaggcggaaatatggcctttgctatt
ggttctgggctgattgctggaggaattgttaaggccagccaagttatggtgtccggaccg
catcttgaaaatctgtctcgctggcgtgatttaggcgcagtgacaactgatgagaactat
gatgtgatggagcacacagatattattttcatttgtgttaagcctcacatgctagccccg
tgtgcagcacagctcaaatacaaatacgttccatcagcaaaggacgctagcaaattgtta
gtctcggttctagcgggcacaacattaaacgccctcgaagagaaattcgcatttattgaa
acatcggcacttaagattatacgaacaatgcctaacacttctatgcaagtgggagaggga
tgcactgtatacgcaggcaactcacattgctcgcaccaagatctagaaaaggtccatttg
atgcttaattctttgggtcttgctcagcaagtgccagagactatgatcgatgccgttaca
ggggtcacaggctgcggaccagcatttgtttataccattatagaggcttttgccgatggt
ggagtaaagcaaggcgtaccgcgccagatggcattgcaattcgccgcccagacattgctg
ggcgctgccaagactgtgctgctgactggaaagcatccagccgttctccgcgacgaggtc
tgttcacctggcggttcgactattgtgggtgtgcacgaactcgaaaagggcaatctaaga
gccacaattattaatgctgtggaaaaggcatcattgcggtcagcggagttgggaaaaaag
taa

DBGET integrated database retrieval system