KEGG   Drosophila navojoa: 115564647
Entry
115564647         CDS       T05898                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen-like
  KO
K16679  wengen
Organism
dnv  Drosophila navojoa
Pathway
dnv04013  MAPK signaling pathway - fly
dnv04214  Apoptosis - fly
dnv04215  Apoptosis - multiple species
dnv04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dnv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    115564647
   04391 Hippo signaling pathway - fly
    115564647
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    115564647
   04215 Apoptosis - multiple species
    115564647
SSDB
Motif
Pfam: TNFR_c6 PepSY_TM Macoilin
Other DBs
NCBI-GeneID: 115564647
NCBI-ProteinID: XP_030245075
LinkDB
Position
Unknown
AA seq 321 aa
MPEMHPLIQRDSAASRAAAAAARAAAAIGTAATATATKLTTTSSSKCNNNNNNNSLTLTI
MRPATKTNSKFHKRRRKRQRSEECSNNSNSSNNSNSITATATTTIRRRCSIPYLSRTGAY
LTLLLLTTTCSLCAVTAASTASTSASTASASSAATGAAAAAAAPASATSSSSSIGGFVPP
SSPCAPQHWWDQVQDKCMPCTVCQGEMIPLRPCQLHIDTVCRSIYELKIDWVVLAKTEPN
WKERRKSSEYEHFDQPTPLQHLTHEQLQQLHEEAAAALPLDWQTGALFIAVLACLLFFSV
AACILIHHMRQWRRMERRLDQ
NT seq 964 nt   +upstreamnt  +downstreamnt
atgccagagatgcatccgttaatacaacgcgacagcgcagctagcagagcagcagcggca
gcagcaagagcagcggcggcaatcggaacagcagcaacagcaacagcaacgaaattaaca
acaacgagtagcagtaaatgtaacaacaataacaacaacaacagcttaacactaactata
atgcgcccagcaacaaaaacaaactccaaatttcacaaacgccgacgaaagcgacagcgg
agtgaagagtgcagcaacaacagcaacagcagcaacaacagcaacagcattacagcaaca
gcaacaacaacaatccgtagaagatgtagcatcccatatctaagcagaactggcgcctat
ctgacgcttctactgctcactacaacatgttccttgtgcgctgttaccgccgcatcaaca
gcttccacctccgcctccacagcctccgcgtctagtgctgccaccggcgctgccgctgcc
gctgccgcacccgcctctgcgacgagcagcagcagcagcattggcggcttcgtgccgccc
agttcgccttgcgcgccgcagcattggtgggatcaggtgcaggacaagtgcatgccctgc
accgtctgccagggcgagatgataccgctgcgcccctgccagctgcacatcgacaccgtt
tgccgctccatctacgagctgaagatcgactgggtggtgctggccaagacggagcccaac
tggaaggagcgccgaaagtcatcggaatatgagcacttcgatcagccgacgccgctgcag
cacttgacccacgagcagctgcagcagctgcacgaggaggcggccgctgcactgcccctc
gactggcagacgggcgccctcttcatagcggtgctcgcctgcctgctcttcttctcggtc
gccgcctgcatactcatccatcacatgcgccaatggcgccgcatggagcgccgactggac
caag

DBGET integrated database retrieval system