KEGG   Diuraphis noxia (Russian wheat aphid): 107161386
Entry
107161386         CDS       T04900                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Pathway
dnx00230  Purine metabolism
dnx01100  Metabolic pathways
dnx04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dnx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107161386
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    107161386
Enzymes [BR:dnx01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107161386
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA
Other DBs
NCBI-GeneID: 107161386
NCBI-ProteinID: XP_015363266
LinkDB
Position
Unknown
AA seq 869 aa
MRGIYLATNSVLLLASNCLGLLSYFLADKQQRTAFLETRQCLEMKMVIEEQSTEQERLLL
SVLPEHVAVKMRQDLGEALDSQFKKIYMSRHENVSILYADIVGFTAISSTYSASDLVKIL
NELFARFDRLSEKYQQLRIKILGDCYYCISGAPKERPDHAVLSVHMGLSMVKAIKYVQQT
TNSPVDMRVGIHTGAVLAGVLGQRQWQFDVYSKDVELANKMESSGMPGRVHISEKTLSFL
NGEFEVEPGYGERREEALKMASIKTFFIIKTIKPFKMDVQNGSLTDQHSASKESVCATPI
DDADLMAQAKEDSDNFKKRLRKDLMNRDGHRDLNKHTKFFTLAFNDEAKEREYKYHKEAA
SGVSJIGCPLVLFLTSSAQIIMLPRDILSYMSSCLALVLLLIIVIVSVADIFPRILPSKI
VWFSETINDSLWIRRILGITAASLLASTNLVGLVSCWSDNQILTNCTHGQSDPSTYCMYP
SYFTYFMVLALIATSMLTQLSHFTKATILFVITLVHCVVNIVTVGTAIDCEDSIIYKPFK
VLPSKYALSFLLIAVTMALVFLARNMDKSSRVLYLWRTEVEEQRERASDIRRRNEALVYN
ILPPHVAKHFLGSYKRQHEELYSQSYAEVGVLFASMPNFSDFYSEETVNNQGLECLRFLN
EVISDFDALLEQPRYQDIIKIKTIGSTYMAASGLNPSRVVKPEDPIEVRWAHLALLVDFA
FDLKKALQGINEQSFNHFVLKMGINHGPITAGVIGARKPHYDIWGNSVNVASRMESTGKA
GCIQVTEETCNILQHFGFKFEQRGLVAVKGKGQLMTYYLVGKGLQPSQVPPPIMETLPEV
EEEDTDECMVVRQALLPRTDHNGSATASG
NT seq 2610 nt   +upstreamnt  +downstreamnt
atgcgcggaatatacttggccacgaacagcgttctacttttggcgtccaattgtttggga
cttttgtcctatttcctggccgacaagcagcagcggaccgcctttctggaaacccggcaa
tgtctcgagatgaaaatggtcatagaagaacaatcgaccgagcaggaacggctgttgttg
tccgtgttaccggaacacgtagccgtcaaaatgcgccaggatttgggtgaggcattggac
agtcaattcaaaaagatatacatgagtcgacacgaaaacgtgagtatattgtacgccgac
atcgttggattcacggcaatatcgtctacatactcagcatcggacctggtaaaaattctc
aatgagctgttcgccagattcgatcgactgtctgagaaataccaacagctcaggattaag
attttgggcgattgttactattgtattagtggcgctcccaaggaacgacccgatcacgct
gtgctcagcgtgcacatgggactctccatggtcaaagctatcaaatacgtacaacagacg
actaattcaccggtggatatgcgggtgggcatacacacgggagctgttttagcaggtgtc
ctgggtcagagacagtggcagttcgacgtttactctaaggatgtggaattggcaaacaaa
atggaaagcagtggaatgccgggacgagtgcatatatccgaaaaaacgttaagtttctta
aatggagaattcgaagtcgagcccggttacggagaacgccgtgaagaagcgctcaagatg
gccagcataaaaacattcttcatcataaaaacgatmaaaccgttcaaaatggatgtgcaa
aacggatcgttgaccgatcagcacagtgccagcaaagaatctgtgtgtgcaacaccgatt
gatgacgccgatttaatggctcaggccaaagaggactccgataactttaagaagcgtttg
agaaaggacttgatgaacagagatggccacagggatttaaacaaacatacaaaatttttc
actttggcatttaatgatgaagcaaaagaacgcgaatacaaataccacaaagaagctgca
tctggtgtgtctmttataggttgtcctttagtgctgtttttaacgtcttccgcacaaatt
attatgttgcccagagatattttaagctacatgtccagttgtctcgcattagtattacta
ttaattattgtgatagtatcagtcgcagacatttttccaagaattttaccatcgaaaatt
gtatggttcagtgagaccattaatgactctttatggatacgacgtattcttggtatcact
gccgcgtcattgctagcgtctaccaatctcgtgggactagtatcgtgttggtctgacaat
caaatactaaccaactgcacgcatggccaaagcgatccatcgacttattgtatgtatccg
tcatacttcacttacttcatggttttggcgttaatagccacgtccatgttgactcagtta
tctcattttaccaaagcaaccatactgttcgtcatcactctggtacattgcgttgtcaac
atagttacagtgggcactgctattgactgcgaagactcgataatttacaaaccattcaaa
gtcttgccatcgaagtatgcgttgtcgtttctactcatagccgtcacaatggcattagtg
tttttggctagaaatatggacaaatcatcgagagtcctatatctatggcgaacggaagtc
gaagaacagagggaaagggcttcagacatacgaaggagaaacgaagcattggtatacaat
attttacctccgcacgtagcaaaacatttcttaggtagttacaagcgtcagcacgaagaa
ctatacagtcagagttatgccgaagttggagttttgtttgcatcaatgccaaacttttca
gatttctattcggaggagacagttaacaatcaaggcctcgagtgtttaagatttctcaac
gaagttatatctgattttgatgcgcttctggaacaaccacgctaccaggatattattaag
attaaaacaatcggttcaacttatatggctgcaagtggactaaacccttcrcgtgtagta
aagcctgaagatccaattgaagttagatgggcacacctcgcattgttggtggattttgct
ttcgatctcaaaaaagcactacaggggataaatgaacaaagctttaaccactttgtattg
aaaatgggaatcaatcatggtccgataaccgccggagttattggtgctagaaaacctcat
tacgatatatggggaaattctgtgaatgtggcgtcaagaatggagagcactggaaaggct
ggatgcatacaagtgactgaagaaacgtgtaatattctgcaacatttcgggttcaagttc
gaacagcgtggcctagtagcggtcaaaggcaagggacagctaatgacctattacttggtt
ggcaaaggcctccaacccagtcaggtaccgccaccaatcatggagacgctgccggaagtg
gaagaagaggacacggacgaatgcatggtggtcagacaggcactgttacctcgaaccgat
cacaacgggtctgcaactgcttccggttaa

DBGET integrated database retrieval system