KEGG   Diuraphis noxia (Russian wheat aphid): 107161701Help
Entry
107161701         CDS       T04900                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Pathway
dnx00020  Citrate cycle (TCA cycle)
dnx00190  Oxidative phosphorylation
dnx01100  Metabolic pathways
dnx01200  Carbon metabolism
Module
dnx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dnx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dnx_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:dnx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107161701
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    107161701
Enzymes [BR:dnx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     107161701
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA HI0933_like DAO FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 107161701
NCBI-ProteinID: XP_015363701
LinkDB All DBs
Position
Unknown
AA seq 659 aa AA seqDB search
MIGLLKIVNPIPRSTYSKINNWSRPLIYTKNLHLSKYYSSKQSTAGTNAYSVIDHEYDAV
VVGAGGAGLRAAFGLVQEGFKTAVITKLFPTRSHTVAAQGGINAALGNMEDDDWRWHMFD
TVKGSDWLGDQDAIHYLTREAPAAVIELENYGMPFSRTDEGKIYQRAFGGQSLQYGKGGQ
AHRTCCVADRTGHSLLHTLYGYSLKFNCNYFVEYFALDLIMDKGECVGVIALCLEDGTIH
RFRAKNTVLATGGYARAYFSCTAAHTCTGDGQALASRAGIPMQDMEFVQFHPTGIYGAGC
LMTEGCRGEGGYLINGLGERFMEKYAPNAKELASRDVVSRSMTIEIMEGRGCGPEKDHVY
LQLYHLPAEQLHARLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYRGQVINPD
NGEDKVVPGLYACGEAACTSVHGANRLGANSLLELVVFGRSCALDIAKYNKPGDKIPQIS
DNAGEESIANIDKLRFKNGTIPTADLRLDMQKTMQLYAAVFRTGSTLDEGRTKMQTIYSK
LKDIKINDRSMVWNSDLVESLELQNLMINAQQTIVSAAERKESRGAHARDDFKDRIDEFD
YKKPLEGQTQVPIEKHWRKHTLACINPESGEIKLTYRPVIDHTLDEKEVKSVPPMIRSY
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgattggtttattaaaaattgtgaatccaatcccacgaagtacttattcaaaaattaac
aattggagccgtccattaatttacacaaaaaacttacatctatctaaatattattcatct
aaacagagtacagcaggaacaaatgcatattcagtaattgatcatgaatatgatgctgtc
gtagttggagctggaggagctggtctccgagccgcttttggtttggtacaagaaggattt
aaaacggcagttattactaaactatttccgacaagatctcatacggttgctgcacaagga
ggaattaatgctgctttagggaatatggaagatgatgactggcgatggcatatgtttgat
actgttaaaggttcagattggttaggagatcaggatgctatccattatttaactagagaa
gcacctgcagctgttattgagttagaaaattatggtatgccttttagtcgcactgatgaa
ggtaaaatatatcaacgcgcatttggtggccagagcttacaatatggaaaaggtggtcag
gctcatcgtacttgttgtgtagctgaccgaactggtcattccctcttgcatactttatat
ggatattcattaaaatttaattgcaattattttgtggaatattttgctttggatttaatt
atggataaaggtgaatgtgttggagttattgctttatgcttggaagatggtaccattcat
cgatttagagctaagaatactgttttagctactggtggttatgctagggcctacttttca
tgtacagctgctcatacctgtacaggcgatggtcaagctttagcgtcaagagctggtatt
ccaatgcaagatatggaatttgtacaattccaccctactggtatatatggtgctggctgt
ttaatgacagaaggttgtcgtggtgaaggaggatatttaatcaatggtttaggtgaaaga
tttatggagaaatatgcacctaatgctaaggaacttgcatctagagatgttgtatctagg
tcaatgactattgaaatcatggaaggaagaggatgtggtccagaaaaagatcatgtttat
cttcaactttatcatttgccagctgaacaacttcatgctagactacctggtatttcggaa
actgccatgatatttgctggagttgatgttactaaagagcctattcctgtgttgccaaca
gtccattataacatgggtggaataccaacaaactatagaggacaggtaatcaatcctgat
aatggggaagataaagtagtacctggattgtatgcttgtggtgaagctgcatgcacttct
gttcatggagctaatcgtcttggagctaattcattacttgagttagtggtatttggacga
tcttgtgctttagatattgctaaatacaacaaacctggagataaaataccacaaattagt
gataatgctggtgaagaatccattgccaacattgataaattacgtttcaaaaatggaaca
atacctacagcagacttacgtttagatatgcaaaaaactatgcaactttatgctgctgtt
tttagaactggatctacacttgatgaaggccgtactaaaatgcaaaccatttattcaaag
cttaaggatattaagataaatgatcgatcaatggtttggaattcagatttggtggaatca
ttagaattacaaaacttaatgatcaatgctcagcaaacaattgtatctgctgctgaacgt
aaagaatccagaggggcacatgcacgagatgatttcaaagatcgtattgatgaatttgat
tacaaaaaaccattagaaggacaaacccaagtaccaattgaaaaacactggagaaagcat
acacttgcatgcataaatccagaatcaggagagatcaaattaacttatagacctgtaatt
gatcacacattggatgaaaaagaagtaaaatcagtgccgcctatgattagatcatattaa

DBGET integrated database retrieval system