KEGG   Diuraphis noxia (Russian wheat aphid): 107162609Help
Entry
107162609         CDS       T04900                                 

Definition
(RefSeq) polycomb group protein Psc-like
  KO
K11459  polycomb group RING finger protein 4
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Brite
KEGG Orthology (KO) [BR:dnx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dnx03036]
    107162609
Chromosome and associated proteins [BR:dnx03036]
 Eukaryotic Type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     107162609
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-rbx1 zf-RING_UBOX zf-C3HC4_4 Prok-RING_4 zf-Nse
Motif
Other DBs
NCBI-GeneID: 107162609
NCBI-ProteinID: XP_015365069
LinkDB All DBs
Position
Unknown
AA seq 605 aa AA seqDB search
MQSCKPKVTDLNPHLLCVLCGGYFVDATTVIECLHSFCRSCIVKYLERNKYCPICDVLVH
KSKPLSNIRPDHTLQNIVYKLVPRLFQKEMVMRREFYNRNKVYLPRDPMSRGVVPDDYHI
FAASDAISICLYYECENIDKKNIHEKHKRYLWCPASLTVINLKKLLYIKYELIPTDHYVE
FFYQNYLLDDHLTLMDVVYMFDWKRKDPLSMTYRILKIEIEPLLNDGIAKEESVVESIKD
BEKSEEKQNDLHQNVVNTEICIEELPKIDENLKVLEKIPDSKEVQLEISENGIMKVTNIN
QSRETIQANVTIEPTDIVKNENSSKPGDINDDKDDDKKKTLKVYPGSKIKKTKPKLDTIV
EKIKKQGTKYKTLTSPTKHWNPSISKTSVLAKKKEINGIDKKCQKFFKSRDDKKDEDKVE
DSLKRLAEVPLMKINPQTLCPIMPSSPAKKPKKPVPKKNTLAHSLALLPVRPTNHNPFTN
PLNPFMYGTFXNNSNGDAGDTNDFLKAMSELCPPSSAYHNSLPPSVSVLFNPLYTHHRQS
QAKKASVAVAQSPDIMKLPANKNEEKSEKIEDKTNDKGNNKDECTNNNKGEEKMEVEKEK
EKKKI
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcctgtaagccgaaggtcaccgacctaaatccacatctactatgcgttctgtgc
ggtggatacttcgtggacgccacgacggtaatcgaatgtctgcactccttttgtcgaagt
tgtattgtcaagtatctcgaacgcaacaaatattgtccaatatgcgatgtattagtccac
aaatcaaaacctttatccaatatccggccggaccacacactgcaaaatattgtttacaaa
cttgttccacgtttatttcaaaaggaaatggtaatgagaagagaattttacaatcgaaac
aaagtgtatttacccagggacccaatgagccgtggtgttgtacctgatgactatcatata
tttgctgcaagtgatgcaatcagtatatgtctttattatgaatgcgaaaatattgacaaa
aaaaatatacatgaaaaacataaacgatatctatggtgcccagcatcattgacagttata
aatttaaaaaaattattatacattaaatatgaattaataccaactgatcattatgtagag
tttttctaccaaaattatttattagatgatcatttaactttaatggatgttgtttacatg
tttgattggaaaaggaaagatccactttcaatgacttatcgaattcttaaaattgaaatt
gaacctcttttaaatgacggtatagcaaaagaagaaagtgtagttgagtcaataaaggac
ratgaaaagtctgaagaaaaacaaaatgatttgcatcaaaatgtagttaatacagagatc
tgtattgaggaactccctaaaatagatgaaaaccttaaggtccttgagaaaattccagat
tctaaagaagtacaattggaaataagtgaaaatggtatcatgaaagttactaatattaat
cagagtagagaaacaattcaagctaatgtcactatagagccaactgatatagttaaaaat
gaaaattcatctaaaccaggagatataaatgacgataaagatgacgataagaaaaaaact
ttaaaagtatatcctgggtcaaagataaaaaaaaccaaacctaaactagacactattgtt
gagaaaattaaaaaacaaggcactaaatataaaacattaacatctccaactaaacattgg
aatccaagcatatcaaaaacttcagtcttagccaaaaagaaagaaataaatggaattgat
aaaaagtgtcaaaaatttttcaaatcaagagatgacaaaaaagatgaagataaagttgaa
gacagtttgaagaggttagctgaagtgcctttaatgaaaattaatcctcaaacattatgt
ccaattatgccttcttccccagctaagaaacccaaaaaacctgttcctaaaaaaaataca
ttagctcattctttggccctactacctgttcgaccaacaaatcataacccatttaccaat
ccattgaatccattcatgtatggaacatttcyaaataattcaaatggagatgctggagat
acaaatgattttcttaaagctatgtctgagttatgtccaccatcatcagcttatcataat
tctttgccaccgtcggttagtgtacttttcaatcccttatatactcatcacagacaaagt
caggctaagaaggcttctgtggctgtagctcaatcacctgacataatgaaattacctgcc
aataaaaatgaagaaaaatctgaaaagatagaagataaaaccaatgataaaggtaataat
aaagacgagtgtactaataataataaaggtgaagagaaaatggaagtcgagaaagaaaar
gaaaagaaaaaaatctaa

DBGET integrated database retrieval system