KEGG   Diuraphis noxia (Russian wheat aphid): 107163884Help
Entry
107163884         CDS       T04900                                 

Definition
(RefSeq) pyrimidodiazepine synthase-like
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Pathway
dnx00480  Glutathione metabolism
dnx00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:dnx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107163884
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    107163884
Enzymes [BR:dnx01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     107163884
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 Glutaredoxin GST_C_5
Motif
Other DBs
NCBI-GeneID: 107163884
NCBI-ProteinID: XP_015366984
LinkDB All DBs
Position
Unknown
AA seq 240 aa AA seqDB search
MAIKHLSKDSVEPPKEPGSLRFYSMRFCPYAQRVQLVLNAKGVLHDTVFINLSDKPEWFL
KIFPAGKVPALVYDNKFLSESLLLADFLDEQYPEPPLHNNSPLQKILDKLVIESFGKVGT
AFYKVMMTTKEIEKNNFDELVNSLIPIETELAERGSTFFGGNKPSMVDYMIWPWFERLDA
INPYSHGTFVIPFENKFPRLTKWKSLMIADKAVAPYYITPEKHAEHFTKRKAGLPAYDII
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggccatcaaacacttgtccaaagattccgtagaacctccaaaggaaccgggttcatta
cgcttctactcgatgcggttctgtccgtatgcgcagagggtccagctggtattgaatgcc
aagggcgtactacacgacacggtgttcattaatctgtcagacaagccagagtggttcttg
aaaattttccccgctggmaaggttccagctttggtttatgataacaagttcctctctgaa
agtctgctgctggcagatttccttgacgaacagtatcctgaacctcctttgcataataat
agtcctctccagaaaattttggacaagcttgtcatagagtcttttggaaaagtcggtaca
gcattttataaggtaatgatgaccacaaaagaaatagaaaaaaataattttgatgaactt
gttaatagtttaattcccattgaaaccgaactagcagaaaggggatcaacattttttgga
ggtaacaagccaagtatggttgactatatgatatggccttggtttgagcgtttagatgct
ataaatccatattctcatggaacgtttgttattccgtttgaaaacaaatttcccaggctg
acaaagtggaaatccttaatgattgctgataaggctgtagcaccgtattacatcactcca
gaaaagcacgcagaacattttacaaaaagaaaggctggattacctgcatatgatattatc
taa

DBGET integrated database retrieval system