KEGG   Diuraphis noxia (Russian wheat aphid): 107164123Help
Entry
107164123         CDS       T04900                                 

Definition
(RefSeq) histone deacetylase Rpd3
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Pathway
dnx04213  Longevity regulating pathway - multiple species
dnx04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dnx00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    107164123
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    107164123
Enzymes [BR:dnx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     107164123
Chromosome and associated proteins [BR:dnx03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     107164123
   HDAC complexes
    Sin3A-HDAC complex
     107164123
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    107164123
  Chromatin remodeling factors
   NuRD complex
    107164123
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 107164123
NCBI-ProteinID: XP_015367308
LinkDB All DBs
Position
Unknown
AA seq 491 aa AA seqDB search
MSITPFKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATA
EEMTKFHSDEYIRFLRSIRPDNMNDYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAA
VKLNKQSADICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGD
GVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMDDDSYESIF
VPIITKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKRYGLPFLMVGGG
GYTIRNVSRCWTYETAVALGAEIANELPYNDYFEYFGPDFKLHISPSNMTNTNATEYLEK
IKNRLFENLRMLPHAPGVQVQAIPEDGVRNESEDEDNVNPDERNPQSITDKRIAPDNEFS
DSEDEGMAPGVGGGGRKDNRSYKTVTPARKQARLDSNRMEVDEPEFNILKDDKEEKSVSS
DDSNKKDAVKS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcactccgttcaaaaagagagtctgttattattacgacagtgatatagggaat
tattattatggacaaggtcatcctatgaaaccacataggattcgaatgactcataatttg
cttttaaattatggtttatatcgaaaaatggaaatatatagacctcataaagcaactgca
gaagaaatgaccaaatttcatagtgatgaatatatacgatttttacgaagtattcgtcca
gataatatgaatgactataacaaacagatgcaaagattcaatgtgggtgaagattgtccg
gtttttgatggtttgtacgaattttgtcagctatctgcgggtggttcagtagcagcagcc
gtaaagttaaataagcaatctgcagatatttgtatcaattggggaggtggtctccatcac
gctaaaaaatctgaagccagtggcttttgttatgttaatgatattgtacttggtatatta
gaattgcttaaataccatcaacgagtattgtacattgatattgatgttcatcacggtgat
ggtgttgaagaagcattttatactactgatagagttatgacagtttcattccataaatat
ggcgaatattttcctggtactggtgatctcagagacattggtgctggaaaaggaaaatac
tatgcagttaacattcccttaagagatggaatggatgatgatagttatgaatcaatattc
gtacctataattactaaagtaatggagacgttccaacctagtgcagttgttttacaatgt
ggagcagattcacttacaggagacaggcttggatgcttcaatctgactgttaaaggtcat
ggtaaatgtgtcgaatttgtgaaacgatatggtttaccatttctgatggttggtggaggt
ggttatactatccgaaatgtatctcgatgttggacgtatgagacagctgtagccttagga
gctgaaattgctaatgaattgccgtacaatgattattttgaatactttggacctgatttt
aaactacatatcagtccttcaaatatgaccaatacaaatgctaccgagtatttagaaaaa
attaaaaaccgactttttgaaaacttacgaatgctacctcacgctccaggagttcaagtc
caagctattcctgaagacggtgtacgtaatgagtctgaagatgaagataatgttaaccca
gatgaaaggaatcctcagtccataacagacaaacgaattgcacctgacaatgagtttagc
gatagtgaggatgaaggaatggctcctggagtagggggtggtggccgaaaagataacaga
tcttataaaacggtaacacctgctagaaaacaagcacgtttggactctaatagaatggaa
gtagatgaacctgaatttaatattctaaaagatgataaagaagaaaaatctgttagttct
gatgattctaataaaaaggatgctgtcaagtcgtga

DBGET integrated database retrieval system