KEGG   Diuraphis noxia (Russian wheat aphid): 107165867
Entry
107165867         CDS       T04900                                 

Definition
(RefSeq) uncharacterized protein LOC107165867 isoform X1
  KO
K20017  Bcl-2 family protein
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Pathway
dnx04214  Apoptosis - fly
dnx04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dnx00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    107165867
   04215 Apoptosis - multiple species
    107165867
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 107165867
NCBI-ProteinID: XP_015369777
LinkDB
Position
Unknown
AA seq 436 aa
MVKQCLKKIWKKFNMPGQLSVWPVCLFSVNKPEIGRIKNSHTSSKRCNEARRMSEGGLVM
STCAAANFNNNNNNNNNTTNTNNNNHNGVSRTTAALPRRKFSFPAVLQSHNLQSELVGVD
FGGGPSLTVATARRRFSNVSDVVSRKLSHTIGWRTAVPTEQIARQGKALCVQYIRWKLKR
AGAYTKKCAGALRAANAAANPTASVDGNSSSGSGGYFIPPLQAMASAAGAGADHIDGVRR
DVFPAVLRVGLQLERLDPKLYAAGTVATDSAAVTAASVAGAAGNPSASAAIISPASSPQR
LFQRHRPTYKRNTAAASVVLVSVSRELFRAGAQVTWAKVVSLVCVAAGLAVDCARRGRAD
QLPDLIEAVGEVIEDDLAAWIHYNGGWMGLQSYCKPVVVNIENPVSTQILYLVSLLILVI
FFLLFLRWFNFISVFR
NT seq 1311 nt   +upstreamnt  +downstreamnt
atggtcaaacagtgtttgaaaaaaatttggaaaaaatttaatatgcccggacaactctct
gtgtggcccgtatgccttttcagtgtcaataaaccagaaattggacgcatcaagaattct
catacttcctcaaaaaggtgtaatgaagcacggcgcatgtccgaaggtggtctcgtcatg
tctacatgcgcggctgccaacttcaacaataacaacaacaacaacaacaacaccacaaac
acaaacaacaacaaccacaacggcgtcagcaggacgacggccgctttgcccaggcgcaag
ttcagcttcccggcggtgttgcagtcgcacaacctgcaatctgaactggtcggtgtcgac
ttcggtggcgggccgtcgctcactgtggccacggcccgccgacggtttagtaacgtcagc
gatgtcgtgtccaggaaactgtcgcacaccatcggctggcggacagccgtgccgacggaa
cagatagcgcgacagggcaaggcactgtgtgtgcagtatatccgatggaagctgaagcgg
gcaggtgcgtatacgaaaaaatgcgctggagcgttgcgcgcggccaacgcagccgctaac
cccacggcttcagtggacggaaatagttctagcggaagtggtggctacttcataccacca
ctacaggcgatggcgtctgcggccggcgccggggccgaccacattgatggtgtgcgccgc
gatgtgtttcctgctgtgctccgggtagggctccagttggagcgtctcgaccctaaactg
tatgcggccggaaccgtggccactgactctgcggccgttacagccgcgtccgtcgctggt
gccgcaggtaacccatcggcatccgcggcgataatcagcccggcatcatcgccacagcgc
ttgttccagcggcaccggcccacgtacaaaagaaacacggcagcagcttctgttgtcttg
gtgtctgtatcccgggaactgttccgagccggcgcccaggtgacgtgggccaaagtcgtg
tcactagtgtgcgtggccgccgggcttgcggttgattgcgcgcgccgtggccgtgccgat
cagctgcccgacctgatcgaggctgtcggcgaagtaatcgaggacgatctggccgcttgg
atacactacaacggtggatggatggggcttcagtcgtactgcaaaccggtggtggtcaac
atcgaaaatccagtgtccactcaaatcctgtatctagtgtcattgctcatactcgtcata
tttttcttgttgtttttgaggtggttcaacttcatatccgttttccgataa

DBGET integrated database retrieval system