KEGG   Diuraphis noxia (Russian wheat aphid): 107166459
Entry
107166459         CDS       T04900                                 

Definition
(RefSeq) uncharacterized protein LOC107166459
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Pathway
dnx04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dnx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107166459
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 107166459
NCBI-ProteinID: XP_015370622
LinkDB
Position
Unknown
AA seq 206 aa
MTVTYGMTGTTTDGGGAVNNGRRVLMAKTDSLSNVNNNNNSTSVNNNNGSASITGKASVL
SVRRVLFGPPADPAETRAWLDRQLCAATAADSRSWNFDFVNERPLRDSPADRYAWERVCP
PKRREEAAATDSTTTTTAQQQQQDCRRTAVKQQRQSKVTDFMSKTKKRPLSASGRTLRSN
KVLDEPESANKRSRPSVATTTTMMAI
NT seq 621 nt   +upstreamnt  +downstreamnt
atgaccgttacgtatggcatgacggggacgaccaccgacggaggaggagccgttaacaac
ggcaggagagtgctcatggcgaaaaccgattccctgagtaacgtcaacaacaacaacaac
agcaccagcgtcaacaataacaatgggtcggcgtcaatcacgggcaaagcgtccgtgttg
agcgtgaggcgcgtgctgttcgggccaccggccgacccggcggagacgcgggcgtggctt
gatagacaattgtgcgcggccaccgcggctgactcgcggtcgtggaactttgatttcgtt
aacgaacgtccgctccgcgacagcccggccgaccgttatgcgtgggagcgtgtctgtcca
ccgaagcgtcgcgaggaggcggccgcaacggactcgacgaccactacgacagcacaacag
caacagcaagattgccgtcgaacggccgtcaagcagcagcgacagtccaaagtcacagat
ttcatgagcaaaaccaagaaacgaccgttgagcgcttccggcaggacattgcgctcgaac
aaagtcttggacgaacccgaatcggcgaacaagcggagtcgcccatcggtcgcgacgacg
acgacgatgatggctatctaa

DBGET integrated database retrieval system