KEGG   Diuraphis noxia (Russian wheat aphid): 107166736Help
Entry
107166736         CDS       T04900                                 

Definition
(RefSeq) hexokinase type 2-like isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Pathway
dnx00010  Glycolysis / Gluconeogenesis
dnx00051  Fructose and mannose metabolism
dnx00052  Galactose metabolism
dnx00500  Starch and sucrose metabolism
dnx00520  Amino sugar and nucleotide sugar metabolism
dnx01100  Metabolic pathways
dnx01200  Carbon metabolism
Module
dnx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dnx_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dnx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107166736
   00051 Fructose and mannose metabolism
    107166736
   00052 Galactose metabolism
    107166736
   00500 Starch and sucrose metabolism
    107166736
   00520 Amino sugar and nucleotide sugar metabolism
    107166736
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107166736
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dnx04131]
    107166736
Enzymes [BR:dnx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     107166736
Membrane trafficking [BR:dnx04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    107166736
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Peroxidase_ext
Motif
Other DBs
NCBI-GeneID: 107166736
NCBI-ProteinID: XP_015371010
LinkDB All DBs
Position
Unknown
AA seq 468 aa AA seqDB search
MIMEEKSMQCMLQTSFEIIEECKILVLSNEQLLALMNDMDKAIRNGLCKETNPSSVVKCY
ITYVQDLPNGTERGKFLALDLGGTNFRVLLIELGEKNYFHMDFETFKVPSKIQTGKGTEL
FDHIAKCLAEFVKKYKLDNKTALPLGFTFSFPLRQVGLTKGYLNSWTKGFDCSGVVNEDV
VRLLKDAIKRRKDVQIDVCGILNDTTGTLMSCAWKTPNTKIGLIVGTGCNACYVEKVENA
ELFDGDKTKSHVIVNCEWGAFGDDGKLDAIRTKYDRDIDENSLNPGQQRFEKMISGMYMG
EIVRLTIVDLANQNKLFKGKLSDQMKTKGAFGASFVSDIESDTGNYKNTLKVLSEMGINN
PSLVDCANVRYICECVSSRSAHLVSVGLAVLLNKMDEKSVTIGVDGSVYRFHPYFHKLIM
EKTRQLVKPDINFDLMLSEDGSGRGAALVAAVAFRDELPSMTNGVAKH
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgataatggaggaaaaaagtatgcagtgcatgctccagacctctttcgagattattgag
gaatgtaagatacttgttttatccaatgaacaactattagccttaatgaacgatatggat
aaagccatcaggaatggtttgtgcaaagaaaccaatccatcttctgttgtcaagtgttat
attacttatgtacaagatttaccaaatggaactgagagaggtaaattcttggctttagac
ttgggtggcaccaattttcgcgtgttattgattgaattgggagagaaaaactacttccat
atggactttgaaaccttcaaagttcccagtaagatccaaactggcaaaggcacagaatta
ttcgatcatattgctaaatgtctggcagaattcgtaaaaaaatacaaactagacaacaaa
acggcattacctttgggctttacttttagttttccacttagacaagttggattaaccaaa
gggtatttaaatagctggactaaaggatttgactgttcaggagtggttaatgaagatgtt
gtcaggcttctcaaagatgctatcaagaggagaaaggacgtacagatagatgtatgtgga
atattgaacgatacaactggtacactcatgtcatgtgcttggaagactccaaacaccaaa
attggacttattgttggaacgggctgtaatgcatgttacgttgaaaaggtggagaacgcc
gaactttttgacggtgacaaaacgaaatcacatgtgatcgtgaactgtgagtggggtgcg
tttggagacgatggaaaattagatgccatccgcacgaaatacgatcgagatatcgacgag
aattcgttgaacccaggacaacaaagattcgaaaagatgatcagtggcatgtatatgggt
gagattgtgagattaaccatcgtggacttggctaatcaaaacaaactcttcaaaggaaaa
ctttccgatcaaatgaagaccaagggagcgtttggcgcatcattcgtgtctgacattgaa
agtgatactggtaactataaaaacacgttgaaagttttgagtgagatgggcattaataat
ccatcgttggtcgattgtgccaacgtacggtacatttgcgaatgtgtgtccagtcggtca
gcgcatctggtatctgtcgggttagctgtgcttctcaacaaaatggacgaaaaatccgtc
acgattggcgttgacggctcggtatatcgctttcatccgtatttccacaaactcataatg
gaaaagaccaggcaactggtgaaacccgacatcaattttgatttgatgttgtccgaagac
ggaagtggtcgtggagccgctcttgttgcagctgtagcttttcgagatgaattaccatct
atgacaaatggagtggcaaagcattaa

DBGET integrated database retrieval system