KEGG   Diuraphis noxia (Russian wheat aphid): 107167771Help
Entry
107167771         CDS       T04900                                 

Definition
(RefSeq) uncharacterized protein LOC107167771
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Brite
KEGG Orthology (KO) [BR:dnx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dnx01001]
    107167771
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dnx04090]
    107167771
Enzymes [BR:dnx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107167771
Protein kinases [BR:dnx01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   107167771
Cytokine receptors [BR:dnx04050]
 Receptor tyrosine kinase
  RTK class X (LTK receptor family)
   107167771
CD molecules [BR:dnx04090]
 Proteins
  107167771
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAM Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 107167771
NCBI-ProteinID: XP_015372439
LinkDB All DBs
Position
Unknown
AA seq 381 aa AA seqDB search
MQTCLRELPLEYFTGITDNGCPTDSHFLCSDNMTCIPYHHVCDISPDCPDETDETENCFL
VPTEARCTFESGFCGWRNASGEMSLTWKLYKGDRHKFTGPKWDNTFRNRTGTYAYVDMSG
SSYLGATARMDSIHFHPPPTYCSDTQSKYYNSCYAVGHDHYIICGTKPINYYLQFEARKL
LSVKGDVAIDDIAMSPKCFGLDVPEDVLKGYKYEAAGTINNTATLTKMPINPDFRNKIVY
KFTTCGSKGRLGPSNRSCEAAYTNTTVSVIVVNDTYMDGVQIWHVPETGVYTSKASVLPN
LPYSYAILMFLIEVAYNYTYKQLSSLKLDVKYPYPIDRVVACFVEFFHVKCVEWAVTYYM
GDGLKWVATVIVWVISHFPFM
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacctgtcttagagaattacctctagaatactttactggcattactgataatggt
tgtccaacagactcacactttttgtgttctgataatatgacatgtataccttaccatcat
gtttgtgatatcagcccagattgtcccgatgaaacggatgaaaccgaaaactgttttctc
gtacccaccgaagctcgatgtacgttcgagtctgggttctgtggatggcggaatgcgtcg
ggtgaaatgtctctgacgtggaaactgtacaaaggcgatcgacataaatttacaggaccg
aaatgggataacactttccgcaaccgaactggtacctacgcttacgtagacatgtccgga
tcgtcctatctcggggcgactgcgcgtatggacagcatacatttccacccaccaccgacg
tactgttccgatacacagtcgaaatattacaattcttgttatgccgttggacacgaccac
tatataatatgtggcaccaaacctataaactattatttacagtttgaagctcgaaaacta
ctatcagtaaaaggggatgtggcgatagatgatatagctatgagtccaaaatgctttggt
ttagatgtaccagaagacgtactcaagggatacaagtacgaagctgctggaacaataaat
aatacggccacgcttacgaagatgcccatcaatccggatttccgaaacaaaatcgtttat
aaatttacaacttgtggatcaaaaggtagactgggccctagtaatcgatcgtgcgaagct
gcatacacaaatactactgtttctgtgatagtggttaatgacacatatatggatggagta
cagatttggcatgtacctgagacgggagtatataccagtaaagcaagtgtattgccbaat
ttgccatatagctatgctattttaatgtttctgatagaggttgcatataattacacctat
aaacaattaagtagtctaaagttggatgtcaagtatccttatccaattgatcgcgttgtc
gcctgctttgtggagttctttcacgttaaatgcgtggagtgggcagtcacttattatatg
ggagatggactgaagtgggtggccacagtyatagtttgggttatctctcattttccattt
atgtag

DBGET integrated database retrieval system