KEGG   Diuraphis noxia (Russian wheat aphid): 107168505
Entry
107168505         CDS       T04900                                 

Definition
(RefSeq) fibroblast growth factor 1-like
  KO
K18496  fibroblast growth factor 1
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Brite
KEGG Orthology (KO) [BR:dnx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dnx04052]
    107168505
   00536 Glycosaminoglycan binding proteins [BR:dnx00536]
    107168505
Cytokines and growth factors [BR:dnx04052]
 Growth factors
  Growth factors (RTK binding)
   107168505
Glycosaminoglycan binding proteins [BR:dnx00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107168505
SSDB
Motif
Pfam: FGF DUF4500
Other DBs
NCBI-GeneID: 107168505
NCBI-ProteinID: XP_015373426
LinkDB
Position
Unknown
AA seq 180 aa
MDQEEEETSQTTTYNVAASKSHMLSNAHVSNGHSSQQNQKSVIIDSRVLKHYGRRMKLNC
RHGYNILILQDGKVSSSDDDIDSHCVMEFTSMFPGHVRIRGVEANLFLAMNKDGLLYGEA
DPNNSSTIFIEQPEGPYSAYLSYKYQRKKWYVAIKKNGKIKLGPTTKRGQHATHFLTIVV
NT seq 543 nt   +upstreamnt  +downstreamnt
atggaccaagaagaagaagaaacatctcaaacaacaacatacaatgtwgcagcttccaag
agtcacatgttgagcaatgcacatgtgtcaaatggtcattcttctcagcagaatcaaaaa
tcagtaattatcgactcacgtgtgctcaaacattatggccgaaggatgaaattgaactgc
aggcatgggtataatattttaatacttcaggacggaaaagtgtctagttctgatgacgac
atagacagtcattgtgtgatggaatttacatcaatgtttcctggtcatgtccgtattaga
ggagttgaagccaatttgtttttagctatgaataaagatggacttctttatggagaagcc
gatcctaacaacagttcaacaatattcattgaacaaccagaaggtccttacagtgcatac
ctatcttataaatatcaacgaaaaaaatggtatgtggctataaaaaaaaatggtaaaata
aaattaggcccaacaactaaaagaggacaacatgctacacattttttaacaattgttgta
tag

DBGET integrated database retrieval system