KEGG   Diuraphis noxia (Russian wheat aphid): 107169249Help
Entry
107169249         CDS       T04900                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Pathway
dnx00052  Galactose metabolism
dnx00500  Starch and sucrose metabolism
dnx01100  Metabolic pathways
dnx04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dnx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107169249
   00500 Starch and sucrose metabolism
    107169249
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107169249
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dnx04147]
    107169249
Enzymes [BR:dnx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107169249
Exosome [BR:dnx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107169249
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 107169249
NCBI-ProteinID: XP_015374414
LinkDB All DBs
Position
Unknown
AA seq 657 aa AA seqDB search
MAMINGYGSHPFYLLMEKSGKSHGVFLFNSNAMDIILQPAPAITYRVIGGILDFYFFSGP
TPSDVITQYTEIIGKPFLPPYWSLGFHMSRNFFFRYGQTFEDLVQVYNRTIEAGIPWDTH
WNDIDYMDNKDDFTLSNNFKQLPEYVNNLHKNGMHHIIILDPGIKSRQSNGTIYVPLKDG
LDNNILIKNSAGQPLEGKVWNDIGTVFPDFTHPNATQFWKKQILNFHNIVKFDGLWLDMN
EPANFVNGDFDGCLSFKSGHWESPQYIPGIVGGHLNYKTICMSAIHFAGIHYDLHNLYGL
VETISTHDALSEIMNTRPFVISRSSYPGFGHYAGHWTGDINSSWDDMKQSITDIINFNLF
GIPLVGADICGFHHDTTVELCLRWIQLGAFYPFSRNHNGQYMKDQDPAALGSKVLLSAKK
SLNTRYYLLPYLYSLFWKAHVYGETVVRPLFFEFPSDNNTYGIDTHFLWGAALLILPVLK
EKNHHVYVYLPKDIWYDFYNKTAISSNGNYFVITAPDDTIPLLIRGGYILPTQMPDLTTK
LSRKNHFELLAATKHNQATGFLFFDDGKSLDVWKNDSYNKVQFKLANNTFFSIVEKNNCI
DDNFVLQNITVLGIKEGLTNSQVNGIPFKGYYFNKTEQVLYFKMLNLDLRTPFNLTW
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atggccatgattaatggctatggttcacatccgttttatttattaatggaaaaatctgga
aagagtcatggagtttttttatttaatagcaatgctatggatattatattgcagcctgca
cctgcaattacatatcgcgtgattggcggaattttggatttttattttttttcyggacca
acaccttcagatgttattactcagtacactgaaattattggcaaaccatttctaccacct
tactggtctttaggtttccatatgagtcgcaattttttttttagatatgggcaractttt
gaagatctcgttcaagtttataataggaccatagaagctggtattccttgggacactcat
tggaatgacattgattatatggataataaagatgatttcacactttctaacaatttcaag
caactgcctgagtacgtgaataatttacacaagaatggaatgcaccatattattattttg
gatccaggcattaaatcacggcaatcaaatggaacaatttacgtccctttaaaggatggt
ctcgacaacaatattcttataaaaaattctgctggtcaaccactggaaggaaaagtttgg
aatgacattggaacagtatttccggacttcacacatccgaatgcaactcaattctggaaa
aaacagattttaaattttcacaatattgtaaaatttgatgggttatggttggatatgaat
gaaccggctaattttgtcaatggtgattttgatggatgtttgtcttttaaatctggtcac
tgggaatcacctcaatatattcctggtatagttggtggccatttgaactacaaaactatt
tgcatgtctgccattcattttgctggtattcattatgatttgcataatttatatggactt
gttgaaactatatctactcatgatgcattgtcagaaataatgaatactagaccttttgtc
atttctcgatcttcttatcctggttttggacattatgctggtcactggactggagacata
aactcttcatgggatgatatgaaacaatccataacagatataataaattttaatttattc
ggcattcccctagttggagcagatatatgtggttttcaccacgacactaccgttgagttg
tgcttaaggtggattcaattaggagccttctatccattttcaagaaatcataatggccag
tatatgaaagaccaagatccagcagctttaggctcaaaagttctattatctgcaaaaaaa
tcattgaatactagatattatttattgccatatttgtattcgttgttttggaaagctcat
gtttacggagaaactgtcgttcgacctttgttttttgagtttccatctgataataataca
tatggcatagacacccattttctatggggtgcagcattactaatcttaccagttttaaaa
gaaaaaaatcatcacgtgtatgtatatctcccaaaagatatatggtatgatttttacaat
aaaactgcaatatcaagcaacggaaattattttgtcataacagcgcctgatgacactata
cccttactgatacgagggggttatattttaccaacacaaatgcctgatttaactacaaaa
ttaagtcgtaaaaatcactttgaactcttagcagcaactaaacacaaccaagcaactggt
ttcttattttttgatgatggaaagtctttagatgtttggaaaaacgattcatataacaaa
gtacaatttaagcttgcaaacaatacatttttcagtatagtagagaagaataattgtatt
gatgacaactttgtattacaaaatattactgtacttggtatcaaagaaggactgaccaat
tcacaagttaatggaattccattcaagggttattactttaataaaaccgaacaagtttta
tacttcaaaatgttaaacttagatctaaggacaccattcaatttaacatggtaa

DBGET integrated database retrieval system