KEGG   Diuraphis noxia (Russian wheat aphid): 107170207Help
Entry
107170207         CDS       T04900                                 

Definition
(RefSeq) maltase A3-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Pathway
dnx00052  Galactose metabolism
dnx00500  Starch and sucrose metabolism
dnx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dnx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107170207
   00500 Starch and sucrose metabolism
    107170207
Enzymes [BR:dnx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107170207
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 107170207
NCBI-ProteinID: XP_015375756
LinkDB All DBs
Position
Unknown
AA seq 626 aa AA seqDB search
MRTFDMFLFVVVAFTCXSVNGNVYFHAKNPNNEWWSNTITYQVYPRSFKDSNNDGIGDLK
GIIQKLDHFTDLGIETLWIGPLFKSPMDDMGYDVEDYRMIDPIYGTMADFDELVLEMKKR
NLKLITDIIPNHSSYKCEWFQKSIKQEGKYKDYYIWRDALNKDEVLQNSTIKPILPNNWL
SVFGGPGWTWNDERKQFYYHQFNSKQPDFNIRNPLVHKEILDILAFWIDRGVVGYRFDAI
KHLYESDSFLDEPCLADEDECKINHDSLKHIYTTDQPENIEIINEWREFIDNYMRSKNIT
ISSYLATESYSPKEILMQYYGNSTKPGANVPFNFGLLTVDKRDIVASIDIEINEWLEIMP
ENQVANWVVENHDNPRIPTKFGAEMVPLFTALKLSLPGIEVTYYGSEIGMDNTYVRPDQS
QDPNNAGGKRADESRDYERCPMQWDTSINAGFTEKKSPWLPVNPNYYMLNVESQKKIPTS
NYNFYKKMSQLRRTDTLKNGDLQTYNISKSIYILKRSLLEHESYIVVLNFGSETETVALS
NVISNLKNELYVYLGSANSGYNIGSIVTTVCSPNNSLNLRPQSVVVLTDKYIAPETPTID
TQNAGTQIGSTSISLLSIFLLLRYFL
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgaggacatttgatatgttcttgtttgtagtggtagcatttacatgtrcctccgtgaac
ggaaatgtgtatttccatgctaaaaatccaaataatgagtggtggtcgaacacaataaca
tatcaagtgtatccaagatcatttaaagacagtaacaatgatggtattggtgatttaaaa
ggtattattcagaaactagatcatttcactgatcttggtattgagacgttatggattggt
ccactttttaaatcaccaatggatgatatgggatatgatgtagaagactatagaatgata
gacccaatatatggaacgatggctgatttcgatgaactagttttagaaatgaagaaacga
aatcttaaattaataacggacattatacctaaccattcgagttataaatgtgagtggttc
cagaaatcaattaaacaagaaggaaaatacaaagattattacatatggcgtgacgcttta
aacaaagatgaagttttacaaaattcaacaataaaaccaatacttccaaacaattggttg
agtgtatttggtggtcctggctggacatggaatgatgaacgaaaacaattttattaccat
cagttcaattcaaaacaaccagattttaatatcagaaatccattagtacacaaagaaatt
ttggatatacttgcattttggattgatagaggcgttgttggatatcgatttgatgctatt
aaacatttatatgaaagtgattcattccttgatgaaccttgtctagctgatgaggacgaa
tgtaaaataaaccatgatagtttaaaacatatttatacaacagatcaacctgaaaacatt
gaaattattaatgaatggagagaattcattgataattatatgagaagcaaaaacatcaca
atatctagctatctagccaccgaatcctactcaccgaaagaaatattaatgcaatactat
ggcaattcaacgaaacccggagctaatgtaccatttaacttcggattattaactgttgat
aaacgtgacatagttgcatctatagacatagaaattaatgaatggctagaaataatgccc
gaaaaccaggtggctaattgggtggtggaaaatcatgacaacccaaggataccaaccaaa
tttggtgccgaaatggtaccactctttacagctttgaaattatcacttcctggtatagaa
gttacatactatgggagtgaaattggtatggacaatacgtatgtgagaccagaccaatca
caagatcctaataatgcaggaggtaagagagcggatgaatccagagattatgaaaggtgt
ccaatgcaatgggatacttcaataaatgcaggtttcactgaaaaaaaaagcccatggtta
ccagtaaatccaaattattacatgctcaacgttgaatcacagaaaaaaataccaactagt
aactataatttttacaaaaaaatgtctcaacttcgaagaaccgatacattgaaaaacggc
gatcttcagacgtataatattagtaaatccatatacatattaaagagatcattattggaa
cacgaatcatacatagtcgtattgaattttggaagtgaaactgaaacagttgcattgtca
aatgtcataagcaatctcaaaaacgaactttacgtatacttaggaagtgcaaattctgga
tataatatcggaagtattgttacaactgtttgttcacccaataattcactaaacctccga
ccacaatctgtagttgtattaacagataaatatattgcacctgaaacaccaacaattgat
actcaaaatgcaggcacacaaatcggttccacatcaattagtttattaagtattttttta
ctattaagatattttttatga

DBGET integrated database retrieval system