KEGG   Diuraphis noxia (Russian wheat aphid): 107172228Help
Entry
107172228         CDS       T04900                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Pathway
dnx00562  Inositol phosphate metabolism
dnx01100  Metabolic pathways
dnx04068  FoxO signaling pathway
dnx04070  Phosphatidylinositol signaling system
dnx04140  Autophagy - animal
dnx04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dnx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107172228
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107172228
   04070 Phosphatidylinositol signaling system
    107172228
   04150 mTOR signaling pathway
    107172228
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107172228
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dnx01009]
    107172228
Enzymes [BR:dnx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107172228
    3.1.3.48  protein-tyrosine-phosphatase
     107172228
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     107172228
Protein phosphatases and associated proteins [BR:dnx01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    107172228
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 DSPn PTPlike_phytase Y_phosphatase2
Motif
Other DBs
NCBI-GeneID: 107172228
NCBI-ProteinID: XP_015378004
LinkDB All DBs
Position
Unknown
AA seq 440 aa AA seqDB search
MDEQSTGLVHSSSIRTRMAIPNIKMTNPIKKLVSKQRKRYTEDGFNLDLTYIQHNVIAMG
FPAENLEGVVYRNHIDDVSRLLDQKHPNHYKIYNLCSERSYDSRKFHQRVATYPFQDHNP
PSIEVIKPFCEDVHQWLAEDSRNVAAVHCKAGKGRTGVMICCYLIHSLQCLSAEEALNYY
GQKRTFDKKGVTIPSQRRYVNYYALLVEKNLNYKPVVLTVKEIKLDPVPNIFNSGQTCIR
LVISEWINGDSSKIRKVYSSDVQDMRRNASDVTIRLTQMTQVLGDVKVECYNKHKMKKKE
KLFHFWFNTFFVCEPAVTENSNRENKHCGQQEKTVHTNSMNDSNNFRFPNNQMRTNSNGH
VGGSDNRLLTLNMNKWDLDGHKDKQNKLFSADFHVSLLFERTDVSEPVVGETLSESESSS
CTTAEEEEDGWESGFRKPVA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggacgaacaatctactggtctggtgcatagctcgtcaatccgcaccagaatggccatt
cctaacatcaaaatgactaatccaattaaaaaactggtcagtaaacaaagaaaacgttat
actgaagatgggttcaacctcgatttgacttacattcaacacaatgtgatagcaatggga
tttcctgcagaaaatttagaaggtgtagtctaccgaaatcatatagatgatgtaagcaga
ctgcttgatcagaaacatcctaatcattataaaatatataatctttgttcagaacgatct
tatgattctcggaagttccaccagcgtgtggctacctacccatttcaagatcataaccca
ccaagcattgaagtgatcaaacctttttgtgaagatgtccatcaatggctcgctgaagac
agcagaaatgtagctgctgtacattgtaaagctggaaagggccgaactggtgtaatgata
tgttgttatctaatacatagtctacagtgtttatcagcagaagaagctcttaattattat
ggacaaaagagaacatttgataaaaagggtgtcactattcccagtcaaaggagatatgtc
aactattatgcattgttagttgaaaaaaatttaaattacaagcctgttgtattgactgta
aaggaaataaaattagatccagtgcctaatatttttaattcggggcaaacatgtattcgt
ttagtgatatcagaatggatcaatggtgatagttcaaaaatcagaaaagtttattcatct
gatgtgcaggatatgcggcgtaatgcttctgatgtaacaattcgtttaacgcaaatgacc
caagtccttggagatgtaaaagtagagtgttacaataaacataaaatgaagaaaaaggaa
aaactatttcatttctggtttaatacatttttcgtttgtgaaccagctgttactgaaaat
agtaatagagaaaataaacattgtggccagcaggaaaaaacagttcatacaaatagtatg
aatgactcaaataactttcgatttccaaataatcaaatgcgtacaaactcaaatggtcat
gtgggtggaagtgataatcgcctgttgacattaaacatgaacaaatgggatttggacggc
cataaagataaacaaaataaactttttagtgctgacttccatgtaagtttattatttgaa
cgtactgatgtttccgaaccagttgttggtgaaacgctatcagaaagtgaatccagtagt
tgcacaacagctgaagaagaagaagatggatgggaatctggctttcgtaaacctgtcgct
tga

DBGET integrated database retrieval system