KEGG   Desulfomicrobium orale: AXF15_05735Help
Entry
AXF15_05735       CDS       T04289                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
doa  Desulfomicrobium orale
Pathway
doa00500  Starch and sucrose metabolism
doa01100  Metabolic pathways
doa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:doa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AXF15_05735
Enzymes [BR:doa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     AXF15_05735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417 Glyco_trans_1_4
Motif
Other DBs
NCBI-ProteinID: AMD92653
UniProt: A0A0X8JQG6
LinkDB All DBs
Position
complement(1271013..1273589)
Genome map
AA seq 858 aa AA seqDB search
MQPFHTYTVVPKLPERLQPLKDLAHNLYFSWHHEVEDFFAQMDRELWEKSEHNPVLFLNH
LPQGMLEELAEDEFFLDRLSTVAANFRKYMEKRGSAGFDGLGQGPVVAYFSAEYGIAQCL
PVYSGGLGILAGDHLKSASDLNIPLVGVGLCYQRGFFRQYLTHDGWQQERYQANDFDEMP
LSPVLDANAEPLRVRIVMQGRPLFFRIWRADVGRIPLFLMDTNVAENTPDRREITAQLYG
GDLEMRIMQEFLLGIGGVKALEAMGMSPRVIHMNEGHSAFAGLERIRALMHERGLSFEAA
MELVAQSSVFTTHTPVPAGNDRFPMELMERYFQEYAADLGLSWKVFLALGRENTRDDSET
FCMTVLALRLSRFNNGVSRLHGEVSRKMWARVWPQYPEKDVPITSVTNGIHFPSWVAPEM
SMLYDRFLGQSWREDPDCERVGEKFGTIPDIELWRTHERLRERLVDFVRRRMQKQIISRG
GRNWELEIAENVLDPEALTIGFARRFASYKRAYLLLKDDDRLKRLMSNPARPIQFIFAGK
AHPRDNEGKKIIQELIALCQAKDTQAKMVFLEDYDIQVARHLVQGCDVWLNNPRRPLEAC
GTSGMKAMANGVLNLSTLDGWWDEAWMPDNSVGWAIGNAEKYDDLEYQDFVESQILYNIL
ENDVIPLFYERGQSSFPRRWAQRMKQALKLLGPVFNGHRMVEEYARRAYLPSSDSYARLS
ADGYRPARELAEWRMKLLTSWGELGIRNIRSGSNGEMFVGEDLEVSAEILVRDLDIADIQ
VEIYTGPLDYTGSFSSRSTFIMHPEGQTEDGWHIYRGSARPLSAGKFGFTVRVLPCHPLL
RDPHSLGLIFWADEAVQG
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgttccacacctataccgttgtacccaaactgccggaaaggctgcaaccgctg
aaggacctggcgcataacctgtatttctcctggcaccacgaggtggaagattttttcgcc
cagatggacagagagctgtgggaaaagagcgaacacaatcccgtcctgttcctgaaccac
ctgcctcagggcatgctggaagaactggcggaggatgaatttttcctggaccgcctgtca
accgttgctgcgaacttccggaaatatatggagaaacgcggttccgccggtttcgacggc
ctggggcaggggccggtggtcgcctatttcagcgccgagtatggtatcgcccagtgtctg
cccgtgtattccggaggactgggcattctggcgggagaccatctcaagtccgccagcgac
ctgaacatccccctggtgggtgtaggactctgctatcagcgcggttttttccggcagtat
ctgacccatgacggctggcagcaggagcgctaccaggccaacgatttcgacgagatgccc
ctttcccccgtgctggacgccaacgccgaaccgctcagggtacgcatcgtcatgcaggga
cggccgcttttcttccgcatctggcgggccgacgtgggccggattcccctcttcctcatg
gataccaatgtcgccgagaacacgccggaccgcagggaaataacggcccagctctacggc
ggcgacctggaaatgcggatcatgcaggaatttctgctgggcatcggcggggtcaaggcc
ctggaggccatgggcatgtcgccccgggtcatccacatgaacgagggacattccgccttc
gccggactggaacgcatccgggcgctcatgcacgagcggggtctgagtttcgaggccgcc
atggaactggtggcccagagttccgtattcaccacgcacaccccggtcccggcgggcaat
gaccgctttccgatggagctcatggagcgctattttcaggaatacgccgccgatctgggc
ctttcctggaaggtcttcctggccctggggagggaaaacacccgtgacgacagcgaaacc
ttctgcatgacggtgctggccctgcgcctgtcgaggttcaacaacggcgtaagccgcctg
cacggcgaggtttcccggaaaatgtgggccagagtctggccccagtacccggaaaaggat
gtgcccatcacctccgtgaccaacgggattcacttcccctcctgggtggcgccggaaatg
tccatgctctacgaccgctttctgggacagtcctggcgagaggatccggactgcgaacgg
gtgggggaaaaattcggcaccattccggacatcgagctgtggcgcactcacgagcggctg
cgggagcggctggtggatttcgtgcggcgccggatgcagaagcagatcatttcccggggc
ggccgcaactgggagctggaaatcgcggagaacgtgctcgatcccgaagccctgaccatc
ggctttgcccgccgcttcgcctcgtacaagcgggcctacctgctgctcaaggacgacgac
cgcctgaaacggctcatgtccaatccggcccggcccatccagttcatcttcgcgggcaag
gcccatcccagggacaacgagggaaagaagatcattcaggagctgatagccctgtgtcag
gccaaggacacgcaggccaagatggtctttctggaggactacgacatacaggtggcccgg
catctggtgcagggctgcgacgtatggctgaacaacccccgccgtcctctggaagcctgc
ggcaccagcggcatgaaggccatggccaacggcgtgctgaacctgagcactctggacggc
tggtgggacgaggcctggatgcccgacaacagcgtgggctgggccatcggcaacgccgag
aagtacgacgacctggaataccaggatttcgtggagagccagattctgtacaacattctg
gagaatgacgtcattccgcttttctatgaacgcggacagagttccttcccccggcgctgg
gcgcagcgcatgaagcaggccctgaagcttctgggaccggtgttcaacgggcaccgcatg
gtggaggaatatgcccggcgggcctatctgccctccagcgacagctacgcccggctgtcg
gccgacgggtaccgcccggccagagaactggccgagtggcgcatgaagcttctgaccagc
tggggagagctgggcatccgcaacatccgcagcggctcgaacggggaaatgttcgtgggc
gaagatctggaggtcagtgccgaaattctggtgcgggatctggatatcgcggacattcag
gtggaaatatacaccggccccctcgactacaccgggagcttttcgagccggtccacgttc
atcatgcatcccgaagggcaaaccgaggacggctggcacatctaccggggctcggccaga
cctctgtccgcaggcaaattcgggttcacggtgcgggtcctgccctgtcatccgcttcta
cgcgatccgcacagtctgggactcatcttctgggccgatgaagccgtgcaagggtag

DBGET integrated database retrieval system