KEGG   Dokdonia sp. Dokd-P16: DCS32_04275Help
Entry
DCS32_04275       CDS       T05432                                 

Definition
(GenBank) glycosyl transferase family 2
Organism
dod  Dokdonia sp. Dokd-P16
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glycos_transf_2 Glyco_trans_2_3 Glyco_transf_21
Motif
Other DBs
NCBI-ProteinID: AWH73402
UniProt: A0A2S1QA02
LinkDB All DBs
Position
939691..941181
Genome map
AA seq 496 aa AA seqDB search
MILETVIIVIYTISLIIIFAYSLSQLNLLFNYLRAQRKKDDAVVFNFKDPAQIPFVTIQL
PVYNELYVMERLLDNIALLDYPADKLEIQVLDDSTDESFETTRKHIKRLSDKGLDIKHVT
RTDRSGFKAGALKEGLKVAKGEFIAIFDADFLPEPNWLQRTVPYFKDRNIGVVQTRWGHI
NRDYSLLTKVQAFALDAHFTLEQVGRNSKGHFINFNGTAGLWRKQCIEDAGNWEGDTLTE
DLDLSYRAQLKNWKFKYLEDVETPAELPVVISAARSQQFRWNKGGAENFQKMSRKVLTSK
TISPKTKLHGLLHLLNSTMFLNVLIVAILSIPMLYIKNEYAHLKPYFYVMSFFVISSVIF
FICYWFMFKSIYGGGFKQFLKYTGMFFVFFSIAMGFSLHNSIAVIEGHLGKRSDFIRTPK
FNISELKDSWKGNKYLKKNISINVIFEGLLMLYFGFGMYYASVVGDQGGDFGLFPFHLML
FMGFGFVFFKSLTSKA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgatattagaaaccgttattattgttatttacacgatttcgcttattatcatatttgcg
tatagcttatcacagctcaacttactttttaattacttgcgtgcacaacgcaaaaaggat
gatgctgtagtttttaactttaaagatccagcacaaatcccttttgtaaccatacagctt
cctgtatataatgaactgtatgtcatggagcgtctactagataatattgcgctcttagac
taccctgcagataagcttgaaatccaagtgctagatgatagtacagatgagtcttttgaa
accacaagaaaacacataaaacgtctaagcgataaaggactagacattaagcatgttact
cgaacagaccgttcgggatttaaagcaggcgcattaaaggaaggacttaaggttgcaaaa
ggcgaatttattgccatctttgatgcagattttcttccagaacctaactggttacaacgt
actgttccttactttaaggatcgtaacataggcgtcgtacaaacacgctggggacacata
aacagagattactccctactcacaaaagtgcaggcatttgcacttgatgctcactttact
ctagaacaagtaggtagaaatagtaaaggacattttataaactttaatggaactgctggc
ttatggcgcaagcagtgtattgaagatgctggaaactgggaaggtgatacccttaccgaa
gatcttgacctaagctaccgtgcccaacttaaaaactggaaattcaaatacctagaggat
gtagaaactccagcagagcttccggtagttattagtgctgctcgctctcaacagtttcga
tggaataaaggtggagcagagaacttccagaaaatgtctagaaaggttttgactagcaaa
actatttctccaaaaacaaaactacacggccttctacatttattaaatagcaccatgttt
ttaaatgttctcatagtagcgatattgagtatcccaatgctctatatcaaaaatgaatat
gcacacctaaagccatacttttatgtgatgtctttctttgtaattagtagtgtgattttc
tttatctgctattggtttatgtttaaaagcatttatggtggaggattcaagcaattttta
aagtatacggggatgttctttgtattttttagtattgccatgggattctcacttcataat
tctattgcagtaatagaaggtcacctaggtaaacgaagtgattttatacgtacgcctaag
tttaacataagcgaactcaaagactcttggaaaggtaataagtatctcaaaaagaatata
tcaatcaatgtgatttttgaaggtctcttgatgttgtattttggttttgggatgtattat
gcatctgtagtaggagatcaaggtggagattttggattatttccttttcaccttatgtta
ttcatgggcttcgggtttgtgttttttaaatcacttacaagtaaagcgtga

DBGET integrated database retrieval system