KEGG   Dokdonia sp. Dokd-P16: DCS32_05435Help
Entry
DCS32_05435       CDS       T05432                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
dod  Dokdonia sp. Dokd-P16
Pathway
dod00240  Pyrimidine metabolism
dod01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dod00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    DCS32_05435
Enzymes [BR:dod01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     DCS32_05435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AWH73614
UniProt: A0A2S1QAK3
LinkDB All DBs
Position
complement(1210255..1210914)
Genome map
AA seq 219 aa AA seqDB search
MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPAVDTRYDEEM
VVSHDANEIRSTPVPAAANIPMLADGCDVVGIDEAQFFDDEIVQVCNDLANRGIRVIVAG
LDMDFKGNPFGPMPNLMATAEYVTKVHAVCTRTGNLAQYSYRKAQSEDIVMLGETEEYEP
LSRAAYYKAMLRDRLRKMDVETPEEITTNTSRQTPQDPN
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaatacagtaaatcataaagagcaatttggctggattgaagtcatttgt
ggatctatgttctctggtaaaacagaagaactcatccgcaggctcaaacgcgcgcagttt
gcaaaacaaaaagttgagatttttaaacctgctgtagacacgcgctacgatgaagaaatg
gtggtctcacatgacgcaaatgaaatacgttctacaccagttcctgcagctgcaaatatt
cctatgctagcagatggatgtgatgtggtggggattgatgaggcacaattttttgatgat
gagattgtacaggtttgcaatgatctggcaaatcgcggcatacgagtaattgttgctggt
cttgatatggactttaaaggaaatccttttggtcctatgcctaatctaatggcaacggca
gagtatgtaactaaggttcacgcagtgtgcactcgtacaggtaaccttgctcaatatagt
tatagaaaagcacaaagcgaggatattgtgatgctaggagagacagaagagtatgaacca
ctctcacgtgcggcttactataaagctatgttgcgagacagactacgtaagatggacgta
gaaactcccgaagaaatcacaacaaatacctcgaggcaaacacctcaagaccctaactaa

DBGET integrated database retrieval system