KEGG   Dokdonia sp. Dokd-P16: DCS32_09200Help
Entry
DCS32_09200       CDS       T05432                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dod  Dokdonia sp. Dokd-P16
Pathway
dod00010  Glycolysis / Gluconeogenesis
dod00020  Citrate cycle (TCA cycle)
dod00620  Pyruvate metabolism
dod01100  Metabolic pathways
dod01110  Biosynthesis of secondary metabolites
dod01120  Microbial metabolism in diverse environments
dod01130  Biosynthesis of antibiotics
dod01200  Carbon metabolism
Module
dod_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dod00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DCS32_09200
   00020 Citrate cycle (TCA cycle)
    DCS32_09200
   00620 Pyruvate metabolism
    DCS32_09200
Enzymes [BR:dod01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DCS32_09200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2118 PYNP_C RnfC_N RP-C_C DUF3408
Motif
Other DBs
NCBI-ProteinID: AWH74327
UniProt: A0A2S1QCN7
LinkDB All DBs
Position
2051807..2053495
Genome map
AA seq 562 aa AA seqDB search
MAEVINMPRLSDTMEEGTVATWLKKVGDKIEEGDILAEIETDKATMEFESFNEGVLLHIG
IEEGQTAKVDVLLAIIGEEGEDISGLLNGGDASAKSGEDEASSSDEKEETASQDETSEAS
SDEEESADAGSDIPEGVVVVTMPRLSDTMEEGTVATWLKAVGDKVEEGDILAEIETDKAT
MEFESFQSGTLLHIGINEGETANVDELLAIIGPEGTDVSGVVKSGGATKKEAPKKEEKKE
APKAEKKADAPKAAPKKENNTNSASGSSKPATNTNGGRIFVSPLAKKIADEKGINLSQVK
GSGENGRIVKSDVENFTPSASQSSGAGVQQFVATGEESFEEIENSQMRKAIARGLGKSKF
TAPHYYLNVEFNMENMMSFRKQFNALPDTKVSFNDMIIKATSIALKQHPQVNSQWFDDKM
RLNHHVHIGVAVAVPDGLVVPVVEFANEKSLQQINAEVKVLAGKARDKKLTLPEMEGSTF
TISNLGMFGITDFTSIINQPNSAILSVGAIVEKPVVKDGKLAVGHTMKLTLACDHRTVDG
ATGAQFLQTLKTYIENPVLMLA
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtaataaacatgccgcgtctaagcgacacgatggaagaaggaacagttgct
acttggcttaaaaaagtaggtgataagatagaagaaggagatatccttgccgaaatcgaa
acagataaggcaaccatggagtttgaatcttttaatgaaggtgtgctattgcacatcggg
attgaagaaggtcaaactgcaaaagttgatgtgcttttagcgatcataggtgaagaagga
gaagatatttctggattattgaatggtggtgacgcttccgcgaaaagtggagaagacgaa
gcatcatcttctgatgagaaagaagagactgcatctcaagatgaaactagtgaagcatct
tctgacgaagaagaatcggcagatgctggatcagatattcctgaaggagttgtcgtagtg
acaatgccacgtctttctgatacaatggaggaaggaacagttgcaacttggttaaaggct
gtaggtgataaagtagaagaaggagatatccttgctgaaatagaaaccgataaggcaact
atggagtttgaatcattccagtctggtacattattacatataggtattaatgaaggtgag
acagcaaatgttgacgaacttctagcaatcataggcccagaaggaacagatgtttctggt
gtggtaaaaagcggcggagctactaaaaaagaggctccaaagaaggaagaaaagaaagaa
gccccaaaagctgaaaagaaggcagatgctccaaaggcagcgcctaagaaagagaataat
acaaactctgcttctggatcttcaaaacctgcaacaaacactaatggaggacgcatattt
gtgtctccactagcaaagaaaattgcagacgagaaaggaattaatctttctcaagtaaaa
ggatctggagaaaacggacgtatcgtaaagagtgatgtagaaaacttcacacctagcgct
agtcaatcttcgggagctggagtgcagcaatttgttgcaactggagaagagagctttgag
gaaattgaaaattctcaaatgcgtaaagcaatcgctcgcggacttggtaaatctaaattt
acagcgccgcattactacttgaacgttgagttcaacatggagaatatgatgagcttccgt
aagcagtttaacgcattaccagacacaaaagtttcttttaatgatatgattattaaggca
acgtctatcgctttaaagcagcatcctcaagtaaactctcagtggtttgatgataagatg
cgccttaatcaccatgtgcatattggtgtggcagtagcagtacctgacggtctcgttgtt
cctgtagtagaatttgcaaatgaaaagtcattacagcaaattaatgctgaggttaaagta
ctagctggaaaggctcgtgataaaaaacttacgttaccagaaatggaaggttctaccttt
acaatttcaaatctaggaatgtttggtatcacagattttacatctattatcaatcagcct
aactctgcaatcctatctgtaggagcaattgtagagaagcctgtagtaaaagatggaaag
cttgctgtaggacatactatgaagcttacgcttgcttgtgatcaccgtacagtagatggt
gcaactggcgcacagtttttacaaacgcttaaaacgtacattgaaaacccagtcttgatg
ctggcgtag

DBGET integrated database retrieval system