KEGG   Dokdonia sp. Dokd-P16: DCS32_09980Help
Entry
DCS32_09980       CDS       T05432                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
dod  Dokdonia sp. Dokd-P16
Pathway
dod00061  Fatty acid biosynthesis
dod00780  Biotin metabolism
dod01100  Metabolic pathways
dod01130  Biosynthesis of antibiotics
dod01212  Fatty acid metabolism
Module
dod_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:dod00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DCS32_09980
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DCS32_09980
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    DCS32_09980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dod01004]
    DCS32_09980
Enzymes [BR:dod01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     DCS32_09980
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     DCS32_09980
Lipid biosynthesis proteins [BR:dod01004]
 Fatty acid synthase
  Component type
   DCS32_09980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Bcl-2
Motif
Other DBs
NCBI-ProteinID: AWH74474
UniProt: A0A2S1QD19
LinkDB All DBs
Position
2219405..2220232
Genome map
AA seq 275 aa AA seqDB search
MSYNLLKGKRGIIFGALDPNSIAWKTAERVHEEGGTFVLTNAPIAMRMGQINDLAEKTGS
EIIPADATSLEDLENLVTKAQEILGGKLDFVLHSIGMSINVRKGRAYTDQKYDWTQKGTD
VSAMSFHKVMQTLYKQDAMNEWGSIVALTYMAAQRVFPDYNDMADNKAYLESIARSFGYF
YGKEKNVRVNTISQSPTPTTAGQGVKGFDGFIAYAEKMSPLGNATAQDCADYTITLFSDL
TKRVTMQNLYNDGGFSNTGVSNEVMESFMKAEGHE
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagttataatttacttaaaggaaagcgcggaattatttttggagcattggatcctaat
tcaattgcttggaaaaccgctgagcgtgtgcacgaagaaggaggaacttttgttcttaca
aatgcacctatcgctatgcgtatgggacagattaatgaccttgccgaaaagacaggttca
gaaatcatacctgcagacgcaacatctttagaagatcttgaaaaccttgtaactaaggct
caagaaattctaggtggtaaattagacttcgttttacactctattgggatgtctataaac
gtacgtaaagggcgtgcttacacagaccaaaagtatgactggacgcaaaagggaacagac
gtttctgcaatgtctttccataaagtgatgcaaacgctttataagcaagacgcaatgaac
gagtggggaagcatcgttgctcttacctatatggcagcacagcgtgtttttccagattat
aacgatatggcagataataaggcatacttagagtctatcgcacgtagctttggttacttc
tacggtaaagaaaagaacgtacgtgtaaatacaatctctcaatctcctacacctactacg
gctggacaaggagtaaaaggatttgatggatttatagcttatgcagaaaaaatgagcccg
ttaggtaatgctactgctcaagattgtgcagattataccattacattattttcagacctt
acaaagcgtgtaactatgcaaaacctttataatgatggaggttttagtaatacaggtgta
agtaatgaggtgatggaatcgttcatgaaagcagaaggacacgaatag

DBGET integrated database retrieval system