KEGG   Dokdonia sp. MED134: MED134_04964Help
Entry
MED134_04964      CDS       T03275                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
dok  Dokdonia sp. MED134
Brite
Enzymes [BR:dok01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MED134_04964 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: EAQ40076
LinkDB All DBs
Position
545069..545650
Genome map
AA seq 193 aa AA seqDB search
MKYRFMTIALLSLATLASCKGDKKESEEVIEVVEVEEVEVMPEMQKLTLKLEPKSDSKAS
GSVVFKEEDGVVKFTAVIGGLDEGMHAIHIHDKADCSSADGKSTGGHWNPTNEQHGKWGA
AEGYHKGDIGNFPADENGNGTITMSTDQWCIGCGDPKKDVVGKAIIVHQGTDDFTSQPSG
AAGARISCGGIIK
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacagatttatgacaatagccttactttctctagccacactagcgagttgtaaa
ggtgacaaaaaagaaagcgaagaagtaatagaggttgttgaagtagaagaagttgaagtt
atgccagagatgcaaaaactcactttaaaacttgaacctaagagtgacagtaaagcttct
ggaagtgttgtttttaaagaagaggatggtgttgtaaaatttacagccgtaataggtgga
ctagatgaaggtatgcacgccatacacatacacgacaaggcagactgttcaagtgcagat
ggaaagtctacaggaggacactggaaccctacaaacgagcagcacggtaagtggggcgca
gcagagggatatcataaaggtgatataggtaacttcccagcagatgaaaacggaaacgga
actatcacaatgagcacagaccagtggtgtataggttgtggagatcctaaaaaagatgtt
gtaggtaaagcaattatcgtacaccaaggtacagatgattttacatcacaacctagtggt
gctgcaggagcaagaatttcttgcggtgggattataaagtaa

DBGET integrated database retrieval system